KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_185774Help
Entry
CHLREDRAFT_185774 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K03505  DNA polymerase delta subunit 4
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00230  Purine metabolism
cre00240  Pyrimidine metabolism
cre01100  Metabolic pathways
cre03030  DNA replication
cre03410  Base excision repair
cre03420  Nucleotide excision repair
cre03430  Mismatch repair
cre03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CHLREDRAFT_185774
   00240 Pyrimidine metabolism
    CHLREDRAFT_185774
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CHLREDRAFT_185774
   03410 Base excision repair
    CHLREDRAFT_185774
   03420 Nucleotide excision repair
    CHLREDRAFT_185774
   03430 Mismatch repair
    CHLREDRAFT_185774
   03440 Homologous recombination
    CHLREDRAFT_185774
DNA replication proteins [BR:cre03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    CHLREDRAFT_185774
DNA repair and recombination proteins [BR:cre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CHLREDRAFT_185774
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     CHLREDRAFT_185774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4 Glyco_hydro_3
Motif
Other DBs
NCBI-GeneID: 5727144
NCBI-ProteinID: XP_001701601
JGI: 185774
UniProt: A8JFM4
Position
Unknown
AA seq 136 aa AA seqDB search
MMSSKKDSSKDAKLSSVYRQAKPGAPVGPATPAKTTRASGKRKAQELENATPAPEVLARS
QGEGAVSRADLSQDEQKLRKFDLTTKFGPCAGISRLERWERAAKFGLGPPEEVRAIILAA
GGAGSAADKGLWHERV
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctctaagaaagattcaagcaaggatgccaagctttcaagcgtctatcgccaa
gcaaagccgggcgcgccagttgggcccgcaactccggcgaaaaccactcgcgctagtggc
aagcggaaggcgcaggagctcgagaatgcaacgccagccccagaagttctggctcgtagc
cagggcgaaggcgctgtttcgcgagcggacctgagccaggacgagcagaagctacgcaag
tttgacctgacaaccaagttcgggccttgcgctggcatcagccggttagagaggtgggag
cgtgccgccaagttcggactggggccccctgaggaggtgcgggctatcatcctggccgcg
ggaggtgcgggcagcgcagcggacaaagggctgtggcacgagcgcgtgtag

DBGET integrated database retrieval system