KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195064Help
Entry
CHLREDRAFT_195064 CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cre  Chlamydomonas reinhardtii
Brite
Protein phosphatases and associated proteins [BR:cre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CHLREDRAFT_195064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 5728626
NCBI-ProteinID: XP_001703073
JGI: 195064
UniProt: A8JHJ4
Position
Unknown
AA seq 181 aa AA seqDB search
MGQAASGGLTQGDVDEVIAASKGVFNQAEIEALYKRFRALDRGRKGYISPEEFLSIPELS
INPLAQRLVRSAECPNFRDFVRLVAPFSPRASRDDRLAFIFQVYDVDGDGYISREDMAMM
LKQLAGSSLGEEDTHEIISRVLAQVGAATGSSLERLDLPAFRRALAGADLSNMVVEVGVD
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggacaagccgcgagcgggggcctcacgcaaggagacgtggatgaagtcatagctgcc
tctaaaggcgtattcaaccaggctgagatagaggcgctgtacaagcgcttccgggcgctg
gaccgggggcgcaagggctacatatccccggaggagttcctcagtatccccgagctgtcc
atcaacccgctggcccagcgcctggtgcgctccgccgagtgccccaacttccgcgacttt
gtcaggctggtggcgcccttcagcccgcgcgcctcgcgagacgaccgcctggccttcatc
ttccaggtgtacgacgtggacggcgatggctacatctctcgggaagacatggccatgatg
ctcaaacagctggcgggcagcagcctgggagaggaggacacacacgaaatcatcagccgc
gtgctagcgcaggtgggcgccgccaccggctcttcgctggagcggctggacctacccgcc
ttcaggcgcgcgctggcgggcgccgacctgtccaacatggtggtggaggtgggcgtggac
ctctag

DBGET integrated database retrieval system