KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195575Help
Entry
CHLREDRAFT_195575 CDS       T01039                                 

Gene name
CHLM
Definition
(RefSeq) Mg protoporphyrin IX S-adenosyl methionine O-methyl transferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00860  Porphyrin and chlorophyll metabolism
cre01100  Metabolic pathways
cre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CHLREDRAFT_195575 (CHLM)
Enzymes [BR:cre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     CHLREDRAFT_195575 (CHLM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_11 Methyltransf_31 PrmA CMAS Methyltransf_32 MTS Methyltransf_18 Ubie_methyltran
Motif
Other DBs
NCBI-GeneID: 5727888
NCBI-ProteinID: XP_001702380
JGI: 195575
UniProt: A8JGJ6
Position
Unknown
AA seq 326 aa AA seqDB search
MQCLNTKPFTSARPAVARRSVVAHASRPAQAAALASAMTVATTSAAMASEIAQTADVGSL
TFAVGGVGAVVGLGALLVATDPQKRRSEQMKSFDGDEKEAVKDYFNTAGFERWRKIYGET
DEVNKVQLDIRTGHAQTVDKVLRWVDEEGSVQGITVADCGCGTGSLAIPLALRGAAVSAS
DISAAMASEAEQRYQQAVAAGQGKAPKVAPKFEALDLESVKGKYDTVTCLDVMIHYPQDK
VDAMITHLAGLSDRRLIISFAPKTLSYSILKRIGELFPGPSKATRAYLHREEDVEAALKR
AGFKVTKREMTATSFYFSRLLEAIRE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcctaaacaccaagccttttacctcggcccgcccggctgtggcccggcggagc
gtcgtcgcgcatgcctcgcgcccggcccaggctgccgcgctggcctctgccatgaccgtg
gcgaccacctccgctgctatggcttctgagattgctcaaactgccgatgttggctcgctg
accttcgcggttggcggagtgggcgctgttgtgggcctgggcgccctgcttgtcgctact
gaccctcagaagcgccgctcggagcagatgaagtcattcgacggcgatgagaaggaggcg
gtgaaggactacttcaacactgccggcttcgagcgctggcgcaagatctacggcgagacg
gacgaggtgaacaaggtgcagctggacatccgcactggccacgcgcagacggtggacaag
gtgctgcgctgggtggacgaggagggcagcgtgcagggcatcaccgtggcggactgcggc
tgcgggacaggcagcctggccatcccgctggcgctgcgcggcgccgccgtcagcgcctcc
gacatctccgccgccatggcgtctgaggcggagcagcgctaccagcaggcggtggcggcc
gggcagggcaaggcgcccaaggtggcgcccaagttcgaggcgctggacctggagtccgtc
aagggcaagtacgacacggtcacttgcctggacgtgatgattcactacccccaggacaag
gtggacgccatgatcacgcacctggcgggtctgtccgaccgccgcctcatcatctcgttc
gcacccaagacgctgtcgtacagcatcctcaagcgcattggcgagctgttccccggcccc
agcaaggccacccgcgcctacctgcaccgtgaggaggacgtggaggctgccctcaagcgc
gccggcttcaaggtcaccaagcgtgagatgaccgccaccagcttctacttctcgcgcctg
ctggaggccatccgcgagtaa

DBGET integrated database retrieval system