KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_206090Help
Entry
CHLREDRAFT_206090 CDS       T01039                                 

Gene name
PHGPx1
Definition
(RefSeq) glutathione peroxidase, selenoprotein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00480  Glutathione metabolism
cre00590  Arachidonic acid metabolism
cre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CHLREDRAFT_206090 (PHGPx1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CHLREDRAFT_206090 (PHGPx1)
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CHLREDRAFT_206090 (PHGPx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 5727250
NCBI-ProteinID: XP_001701658
JGI: 206090
UniProt: P83564
Position
Unknown
AA seq 201 aa AA seqDB search
MLLTRKNVAVRPARAARRDVRAMSLLGNLFGGGSKPTSSTSNFHQLSALDIDKKNVDFKS
LNNRVVLVVNVASKUGLTAANYKEFATLLGKYPATDLTIVAFPCNQFGGQEPGTNAEIKA
FASARGFSGAGALLMDKVDVNGANASPVYNFLKVAAGDTSDIGWNFGKFLVRPDGTVFGR
YAPTTGPLSLEKYIVELINSR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcttcttacccgcaagaacgtagctgtgaggcctgcccgcgcggccaggcgcgacgtc
agggccatgtctctgcttggaaacctcttcggcgggggctcgaagcccaccagcagcacc
tccaacttccaccagctgagcgcgctggacattgacaagaagaacgtggacttcaagagc
ctcaacaacagggtggttctggtcgttaacgttgcaagcaaatgaggcctgactgccgcg
aactacaaggagttcgcgactctgcttggcaagtaccccgcgactgacctgaccatcgtc
gctttcccctgcaaccagtttggtggccaggagcctggcaccaacgccgagatcaaggcc
tttgcgtccgcccgcggcttcagcggcgccggcgcgctgctgatggacaaggtggacgtg
aacggcgccaacgccagccccgtgtacaacttcctcaaggtggccgcaggcgacacctcg
gacatcggctggaactttggcaagttcctggtgcgccccgatggcaccgtgttcggccgc
tacgcgcccaccaccggccccctgtcgctcgagaagtacattgtcgagctcatcaacagc
cgctaa

DBGET integrated database retrieval system