KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_96655Help
Entry
CHLREDRAFT_96655  CDS       T01039                                 

Definition
(RefSeq) predicted protein
  KO
K13181  ATP-dependent RNA helicase DDX27 [EC:3.6.4.13]
Organism
cre  Chlamydomonas reinhardtii
Brite
Enzymes [BR:cre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CHLREDRAFT_96655
Spliceosome [BR:cre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    CHLREDRAFT_96655
Ribosome biogenesis [BR:cre03009]
 Eukaryotic Type
  Pre-60S particles
   Helicases
    CHLREDRAFT_96655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C
Motif
Other DBs
NCBI-GeneID: 5728277
NCBI-ProteinID: XP_001702606
JGI: 96655
UniProt: A8ICS4
Position
Unknown
AA seq 602 aa AA seqDB search
DDDEEGAEEDGEDEEDGEDDEEEEEEEEQAQPSGKQARAKQQQQQQQQQKAKGRAKPESE
EEEDDGDDEEEGDGAGSSGDDEEMDEDDDEDGEEEGDEEEEEDRRPSTSGRGDKAAAAKG
AKASAAAAGKGGKGTFYSETPEGTKFSSASFADLNISRPLLKAVEALGYKSPTPIQAACI
PLALAGRDICGSAVTGSGKTAAFALPFLERLLHRPRGLAATYVLVLTPTRELAVQIHSMI
EKLAQFTDINVALIVGGLSLQVQAITLRQSPEVVVATPGRLIDHLRNSQSVGLEDLAVLV
LDEADRLLEMGFREEVAEVVRAAPRKRQTMLFSATFNDQVRDLVALSLKQPVRLAADAAR
AAPKLLTQEIVRLKGPAAAATKEAVCLALCARSFGDRGRTIVFCSTKTKAHRLKILFGLA
GLPPAAELHGNMSQTARLESLESFRRGDTAFLLATDVAARGLDIQGVEVVVNYDAPPKLE
TYLHRIGRTARAGAAGVAVTLVEDGDRGLLKELGKKVGRARLVPAAAVVQWQSRVERLER
DVRAILAEERDEADLRKAEMEANKAVNMMEHESEIMSRPKRTWFVTEKQKRELAARSAQA
AG
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gacgatgatgaggagggcgcggaggaggatggcgaggacgaggaggatggggaggacgac
gaggaggaagaggaggaagaggagcaggcgcagccttcagggaagcaggcgcgggcaaag
cagcagcaacagcagcaacagcaacagaaggcgaagggtcgtgccaagccggagtctgag
gaggaggaggacgacggagacgacgaggaggagggtgacggcgcggggtccagtggggac
gatgaggaaatggacgaggacgatgatgaggacggagaggaggagggggacgaggaggag
gaggaggaccggcggccgagcaccagcggccgcggcgacaaggccgcggcggccaagggc
gccaaggcttctgcggcggcggctgggaagggcggcaaggggaccttttacagcgagaca
cctgagggcaccaagttcagctctgcctcgttcgcggacctcaacatatcgcgcccgctg
ctcaaggcggtggaggctctgggctacaagtcgcccacgcccatccaggccgcctgcatc
ccgctggcgctggcgggccgcgacatttgcggcagcgctgtgaccggcagcggcaagacc
gccgccttcgcgctgcccttcctggagcggctgctgcaccggccgcgggggcttgcggcc
acctacgtgctcgtgctcacacccacacgcgagctggcggtgcagatccactccatgatt
gagaagctggcccagttcaccgacatcaacgtggcgctcattgtgggagggctcagcctg
caggtccaggccatcacgctacgccagtcgcccgaggtggtggtggccacgcccggccgc
ctcatcgaccacctgcgcaacagccagagtgtggggctggaggacctcgcggtgctggtg
ctggacgaggcggacaggctgctggagatgggcttccgagaggaggtggctgaggtggtg
cgggcggcgccgcgcaagcgccagaccatgttgttcagcgccacgttcaacgaccaggtc
cgggacctggtagcgctgtcgctcaagcagccggtgcggctggcggcggacgcagcgcgc
gccgcccccaaactgctcacgcaggagatcgtgcggctcaagggccccgccgccgccgcc
accaaggaggcggtgtgcctggcgctgtgtgcgcgctccttcggcgaccgcggccgcacc
attgtgttctgctccaccaagaccaaggcgcacaggctcaagatcctgttcgggctggca
gggctgccgccagcggccgagctgcacggcaacatgagtcagaccgcccgcttggagtcc
ctggagtccttccggcgcggcgacacggcgttcctgctggcgaccgacgtggcggcgcgc
gggctggacatccagggcgtggaggtggttgtcaactacgacgcgccgcccaagctggag
acctacctgcaccgcatcggccgcacggcgcgcgcgggggcggcgggcgtggcggtgacg
ctggtggaggatggcgaccgcgggctgctcaaggagctgggcaagaaggtggggagggcg
cggctggtgcctgcggccgcggtggtccagtggcagtctcgggtggagcggctggagcgc
gacgtgcgcgccatcctggctgaggagcgcgacgaggcggacctgcgcaaggcggagatg
gaggccaacaaggccgtcaacatgatggagcacgagtcggagatcatgtcgcggcccaag
cgcacatggttcgtcactgagaagcagaagcgcgagctggcggcgcgcagtgcccaggcg
gccggg

DBGET integrated database retrieval system