KEGG   Crassostrea gigas (Pacific oyster): 105317066Help
Entry
105317066         CDS       T03920                                 

Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:crg01001]
    105317066
Enzymes [BR:crg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105317066
Protein kinases [BR:crg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105317066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 105317066
NCBI-ProteinID: XP_011411903
UniProt: K1QWR4
Position
Unknown
AA seq 745 aa AA seqDB search
MARNPSSVSSNNDTAGFLVDPRFVDLKPLGFGGSGVVFSAIDSDCDKAVAIKKLAFHDKK
SCKYALREIKIMRRLKHENVVTVYEILGPNGYQIAGHSSNIPLNELTSLYLVQELLDTDL
QQLIQAQVLTEEHVCLFLYQLIRGLKYIHSANVVHRDLKPSNLLINIEDLSLKIGDFGLA
RIVDMEYSHKGYLTDGVGTCWYRSPELIISPRDYTKAIDMWSVGCIFAEMLTGKPLFSGG
NEMDQIGRILDVTHLNDNEWNKLTQVLPISVLSIRSRSPKTALKSKFKDLSEDALDLLGS
LLLFNPDRRISAEDALDHTFLAEYRCPDDEPIALRSFHVENEVDELSPKTLRRMLGTEVT
EPVIPCGRTCDMNKITDAMATDHVLAKNMENVSRSSSSESLSDKVDNKYSDITQLIQMSE
KLSFLDNSYPSPKELTLQVIVSLPDEENKKEQLSPKEEKTGHRSASKNSCQTNSLQTREE
KRQVVDNGISLMPIRQTEASAVRKDLKISVTKDNDNQLDRAVTSSSSLYTENATNFLNAN
PVLSQEEKLNENSHKVSKNLGSQKKSTNQRQKDRLNEEKRAESPREIPQKAEKNRPRNEY
DKNTETWGKSKEKARGESQKEEKMKRNKIDKNRDSSEISQDFDSMYRLPTEHLLHRRARR
GDDRSSSRLESQLRIHEHRNSQLKLAEFERDRCIGAMGGCNLPPPGLTTSQEDIPALYAE
HRSRSSSGSSETDTNYSDFPRRSEH
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaatccgtcgtctgttagctcaaacaatgatactgctggcttcctggtggat
ccacggtttgtggatctcaagccgctagggttcggtggcagcggagttgttttttctgca
attgacagtgactgtgacaaagccgtagccattaagaaacttgcctttcatgacaagaaa
agctgcaaatatgctctacgtgaaatcaaaataatgcggagactcaagcatgaaaatgtt
gtaactgtttatgagattcttggtccaaatggataccagatagctggacattccagtaat
atccctctgaatgaactcacttccctgtatctggttcaggaattattagacacagacctc
cagcagctgattcaggcccaggtcctcactgaggaacatgtgtgtctgttcctttaccag
ctgatccgaggacttaaatacatccactcagctaacgtcgtccacagggacctgaaacct
tccaatctactgatcaatatcgaagatctgtctttaaagattggcgactttggactggcc
agaattgttgatatggaatactcacataaaggttacctaacagacggtgtagggacttgc
tggtatcgctcaccagagctgattatctcccctagagactacaccaaggccatagacatg
tggagtgtcggttgtatatttgccgagatgttgacgggtaaacctctgttctcggggggt
aacgagatggaccagatcggccgaatcctggacgtgactcacctgaacgacaatgagtgg
aacaagctgacccaggtgttacccatcagtgtcctcagtatcaggtcaaggtcacccaaa
acagctctaaagtcaaagttcaaggacctatctgaggatgctctggatctgttggggagt
ctgctcctgtttaatccggacagacggatctccgcggaggatgccctggatcacaccttc
ctggccgagtacaggtgtcctgatgatgaacctattgcacttagatcattccatgtagaa
aatgaggttgacgagttgtcgcccaagacgctgcgccggatgttggggactgaagtgacg
gagcctgtcattccgtgtgggcggacatgtgacatgaacaagattacagatgccatggca
acggaccatgtcctggccaaaaacatggagaatgtgtcgagatcttcatcatccgagagt
ttgtcagacaaggtagacaataagtactcggatatcactcagctgatacagatgtcagag
aaacttagcttcctagataattcatacccttcccccaaggaactgactttacaagtgatt
gttagccttccagatgaagaaaataaaaaggaacaactttctccaaaggaagagaaaact
ggacatcgctccgcttctaaaaatagctgccaaacaaattctttgcaaaccagagaagag
aagaggcaagtggtggacaatggaattagtttgatgcctattagacaaactgaagctagt
gcagtgagaaaagacctcaagatatcagtgaccaaagacaatgacaaccagctggataga
gctgtgacatcatcatctagtttatacacagaaaacgccaccaattttctaaatgctaac
cctgtattgtcacaagaagagaaactcaatgaaaattcacataaagtctctaaaaattta
ggaagccaaaaaaaatccacaaatcaaaggcagaaagaccgactgaatgaggagaaaaga
gctgagtcgcctcgagaaattccccagaaagccgagaaaaatcgacccaggaatgagtat
gacaagaacacggaaacctgggggaaatctaaagagaaagcacgaggcgagagtcagaag
gaggagaaaatgaaacgaaacaagattgacaaaaacagagacagctcagaaatatcgcag
gattttgattccatgtatcgcttgcccacagagcacttgcttcatcgacgtgcccggcgg
ggagatgatagatcatcaagtcgactcgagtcccaactcagaattcatgaacacagaaac
tcacagctaaagcttgctgagtttgagagagacaggtgcattggggccatgggggggtgt
aacctgccacccccgggactgaccacatcccaagaagatatccccgccctgtacgcagag
catcgaagtcgcagcagcagcggaagttctgaaactgacaccaattattccgacttccct
cgtcgatcggagcactaa

DBGET integrated database retrieval system