KEGG   Crassostrea gigas (Pacific oyster): 105319072Help
Entry
105319072         CDS       T03920                                 

Definition
(RefSeq) septin-7-like
  KO
K16944  septin 7
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:crg04131]
    105319072
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:crg04812]
    105319072
   04147 Exosome [BR:crg04147]
    105319072
Membrane trafficking [BR:crg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    105319072
Cytoskeleton proteins [BR:crg04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     105319072
Exosome [BR:crg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105319072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin
Motif
Other DBs
NCBI-GeneID: 105319072
NCBI-ProteinID: XP_019919187
Position
Unknown
AA seq 174 aa AA seqDB search
MTDLAERKCKRYFFFRGFFFINSLFLTDLYSADYQGPSHRIQKTVKVETTQCLLKENGVQ
LNLTTVDTPGFGDAVDNSNCWQPVIDFIDSKYDEYLNAESRVVRSPTPDTRVHACLYFIA
PTGHGLKPLDVEFMKRLHDKVNIIPLISKADSLTPDECREFKKTVSLLNNSNYK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttagcagaaagaaagtgtaaaagatattttttttttcggggtttttttttt
atcaactctctcttcctgactgacctgtacagtgctgattaccagggcccctcccacagg
atacagaaaaccgtcaaggttgaaaccacacaatgtcttctcaaagaaaatggagtacag
ttaaatctgaccactgtagataccccaggctttggagatgctgtggacaatagtaactgc
tggcagccagtgatagatttcatagacagtaaatatgatgaatatttaaatgctgagtcc
agagtggtgcggtcccccaccccagacaccagagtccatgcctgcctttatttcatcgca
ccaactggtcacggtctgaaacctttagatgtagagtttatgaagaggctacatgacaaa
gtgaacattatacctctcatctctaaagcagattcccttaccccagatgagtgcagggaa
ttcaagaaaactgtaagcttgttaaacaacagcaactataaatag

DBGET integrated database retrieval system