KEGG   Crassostrea gigas (Pacific oyster): 105320307Help
Entry
105320307         CDS       T03920                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:crg01001]
    105320307
Enzymes [BR:crg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105320307
Protein kinases [BR:crg01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   105320307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 105320307
NCBI-ProteinID: XP_011416487
Position
Unknown
AA seq 376 aa AA seqDB search
MHRNVDKHGHQKPLRLMMMGDFQTRNLQPKKNPISDDYRITGSVLGLGINGKVVECFSKT
TNRKCALKVLRDIPKARREVDLHWRASGCRHIVAILDVYENVYSGQKCLLVVMECMEGGE
LFNRIQERADSAFTEREAASVITDIAKAIHYLHSVNIAHRDLKPENLLYTKKGPDGVLKL
TDFGFAKEIHTIKSLQTPCYTPYYVAPEVLGPEKYDRSCDMWSLGVIMYILLCGYPPFYS
NHGAAISPGMKKRIRNGQYEFPNPEWSKVSKDAKDLIRGLLKTVPEERLSIEDVMRNKWV
ADNTIVPATPLFSAKILQEDKDMWLDVQEEMTNALATMRVDYEQCQIKNLEDSDNPILKK
RRQQKQEGDQPMEFKS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaaatgtggataagcatggacatcagaagccactgagacttatgatgatggga
gattttcagacccgaaacctccagccgaagaagaacccgattagtgatgattatcgcatt
acggggagtgtattgggtttgggtatcaatgggaaagttgtggaatgtttcagcaagacg
accaataggaaatgtgctctgaaggttttgagggacatccccaaagcacggcgagaggtt
gatctacactggagagcctcaggatgtcgacacatcgtcgccatattggatgtgtacgag
aacgtctacagcggtcaaaagtgtctcctggttgtaatggaatgcatggaagggggtgag
ctgttcaacagaattcaagagcgagcagattctgcgttcacagaaagagaggcagcatca
gtaatcacagatattgccaaagccatccactatcttcactctgtcaacatagcccacaga
gacttgaagccggagaatcttctgtatacaaagaaaggaccagatggagtcctgaaactg
acagactttgggttcgccaaagagatccacacgataaaaagtctacagacgccctgttat
accccgtactatgtggcacctgaggttctgggtccagagaagtacgacagatcctgtgat
atgtggtcgctaggtgttataatgtatatattgttatgtggatacccaccattctatagt
aatcacggggcagctatttcacctggaatgaagaaacgaattaggaatggacaatacgag
ttccccaatccagagtggagcaaagtatcaaaagatgcaaaagatttaattagaggacta
cttaaaactgtgccagaggaaaggttgtctatagaagatgtaatgagaaacaaatgggtt
gcggacaacacaattgttccagcgacacctctgttttctgcaaaaattttacaagaagat
aaagacatgtggctcgatgtccaggaggagatgacaaacgcactggcgaccatgcgagtg
gactacgaacagtgtcaaatcaagaatctagaggactcggataacccaatactgaaaaaa
cgcaggcagcaaaaacaggaaggggaccagcccatggaattcaaatcatag

DBGET integrated database retrieval system