KEGG   Crassostrea gigas (Pacific oyster): 105321837Help
Entry
105321837         CDS       T03920                                 

Definition
(RefSeq) myotubularin-related protein 3 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00562  Inositol phosphate metabolism
crg01100  Metabolic pathways
crg04070  Phosphatidylinositol signaling system
crg04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105321837
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105321837
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105321837
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:crg01009]
    105321837
Enzymes [BR:crg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     105321837
    3.1.3.64  phosphatidylinositol-3-phosphatase
     105321837
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     105321837
Protein phosphatases and associated proteins [BR:crg01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    105321837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE FYVE_2 Y_phosphatase DSPc 3-PAP Y_phosphatase3 DUF4441
Motif
Other DBs
NCBI-GeneID: 105321837
NCBI-ProteinID: XP_011418605
Position
Unknown
AA seq 1065 aa AA seqDB search
MHLKMAYADEPTSIECINRSDLFPKKKLVREDESLQIPIPLLPGEAGEFLGRTTDGVIAL
SNYRLLVTFKKAFVNVPIGMIDSVERTDIFFLNIYCKDATVARCGFNDNDACQSWYLRIM
SKLTAPKQLNEFFAFTFHAWCQDHNSGSQDPENCHQLCQKDETYTYSFGKEIERQKFDLK
SGKAWRITYVNEDFSLCPTYPRNHIVPASITDDEIKSSAGFRSLKRFPSVVWRNQRNGAV
LVRCSQPEIGFFNWRNTEDENLMKAFSEACEQNPGKSQKNPNISEDTSGSESGSQSEEDL
DGSDKRVMIVDCRSYRASMANRLKGGGVECVEYYPTCDIQFMNLDNIHAIRKAFTQLRQH
CSTASDQLNWLSSLEGTKWMTYLANLLRTACLVVNVMSKERRSVVVHCSDGWDRTSQIVS
LAELMMDPYYRTVEGFQVLVEREWLEFGHKFADRCGNGVNSEDPNERSPVFLQWLDCVYQ
LFKQFPCAFQFNEAYLIKMVQHTYSHLFGTFLCNTARERLQGELSVQTSSLWSLLHPSNS
QFYNHLYSPSKEQQVLRPKFDVRNLTLWTSVYFSNYTCSTDLKDLGCDQQEMQQETNTCN
LQKTRSCENLAGPSQEPISSPSRRKSDPSIILDNFDPSSLTKDCDKTSSNVCVSNGTVHS
EDGHKDSELKNGTSPEKEQNGDVSASNGVVSNGHCSDLEEENLTNGNQDSKDDTEPESND
ENNLVNGQCNGNSHHNGDTDTTSPAIECSTDTITDGESKPEEKIDHQLNGTMPAHKLSLE
KLVTLEKSASISTSTSDISNSNVDLRLPVDSMYSIHQYLSRSTPLRLTCSSNGFSQSKSP
LKSLPTTPVNSQSSTCPPTPATDKSSESQFCHKVGRLSRHLDSDGLTTFNDPVQQGIQKI
KEDYEREIKVIRNHLAAANAALLQHASACSGGTRCILDKDDMLLSPDVNGDFNSLGSNAA
SDVSWENIDENESKMIRWVPDHAVTHCAECESGFGLLVRKHHCRNCGNIFCGNCSENFSM
IPHQNLMTPERVCNRCFNNLQRISKHVRASNGVVDERPLAYAASN
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgaaaatggcatatgctgatgagccaactagtatagaatgcatcaacagatca
gacctgttcccaaaaaagaaactggttcgggaggatgaatccctccagatccccattccc
cttcttcccggggaagccggggaattcctgggaaggaccactgatggggtcattgctctg
tccaattacagactcctggtcacgttcaagaaggcctttgtaaatgtgcccatcggaatg
atcgattccgtcgaacggacagatatcttcttcctgaacatctactgcaaggatgctaca
gtagcaaggtgtggctttaatgacaatgatgcctgtcagtcatggtacctccgtatcatg
agcaagctgaccgctcccaaacagctcaatgagttctttgccttcacttttcacgcctgg
tgccaagaccataactctggttctcaggatccagaaaactgccatcagttgtgccaaaaa
gatgagacctacacatacagtttcgggaaagagatcgagagacagaaatttgatctgaag
agtgggaaggcgtggcgcatcacctatgtcaacgaagacttcagtctgtgtcccacgtac
cctcggaatcacatcgtaccggccagcatcactgatgacgagatcaagagttcggctggc
ttccggtctctcaagaggttcccctccgtggtgtggagaaaccaaagaaatggtgcagtg
cttgttaggtgcagtcagccggagatcgggttctttaactggcggaacacggaggacgaa
aacctgatgaaggctttctccgaggcttgtgaacagaaccctggaaagagtcagaaaaat
cccaacatcagtgaggacaccagcggctcagaatccggctcacaaagtgaagaagacctt
gatggatcagacaagagggtcatgatagtggactgtaggtcctaccgagcgtccatggca
aaccgactgaaaggagggggagtggagtgtgtagaatattatcctacatgtgatattcag
tttatgaatttggacaacatccatgccataaggaaagcgttcactcagttacggcagcac
tgtagtactgcatccgaccaactcaactggctctcgagtctggagggaactaaatggatg
acatacttagccaacctgctgcggacggcatgtttggtggtgaatgtaatgagtaaggag
cggcgctcggtggtggtgcattgctcggatgggtgggataggacctctcagattgtgtcc
ttggcggagttgatgatggacccctactacagaactgtagagggctttcaagtgctggtg
gagagggagtggttagaatttggtcacaagtttgcagataggtgtggcaatggagtgaac
tccgaagaccccaatgaacggtctccagtgtttctccagtggctggactgtgtatatcag
cttttcaaacagttcccatgtgcattccagtttaatgaagcatatctgattaaaatggtt
caacatacgtattcccacttgtttggaacttttttgtgtaacacggctcgggagaggtta
cagggagagttatcggtacaaacctcgtctctgtggagtctgcttcatcctagtaattct
cagttctacaatcatttgtattcacccagcaaggagcaacaggtattaagaccaaaattt
gatgtcagaaatttaactctttggacatcagtttacttttccaattacacctgttcaacc
gacctgaaagacttaggatgtgatcaacaggaaatgcaacaagaaaccaacacctgtaat
ctacagaaaactcgatcctgtgagaatctggcagggcccagtcaggagcccattagtagt
cccagtcgtaggaaaagcgaccctagcattatattagataactttgacccttctagcttg
acaaaagactgtgataagacttctagcaatgtttgtgtgtccaatggaactgtacattct
gaagatggccataaagacagtgaattaaagaacggaacatctccggaaaaagagcaaaat
ggagatgtttctgctagtaatggagttgtttcaaatggccattgtagtgatttagaagag
gagaatttaacaaatggaaatcaagatagcaaagatgatactgagccagagagtaatgat
gaaaataatctagttaatggacaatgtaatggaaattctcatcacaatggggataccgat
acaacaagtccggccattgaatgttcaacagatactatcacggatggggagagcaaaccc
gaggagaagatagatcatcaacttaatggcaccatgcctgcacataaattaagtctagaa
aaattagtgactcttgagaaaagtgccagcattagcaccagcactagtgatatctctaat
tccaatgtggacttgagactccctgtggacagtatgtacagtattcatcagtatctgagt
cggtccacgcctttacggctgacctgcagttccaatggattcagtcagtcaaagagtccg
ctcaaaagtttgccaaccactccagtcaattcccagagttccacttgtccaccaacacca
gcaactgacaagtcttctgaatcccagttttgtcacaaggtggggcgcctcagcagacat
cttgattctgacggactcacaacctttaatgatcccgttcaacaaggcatacagaagatt
aaagaggattatgaaagagaaattaaggtgatcagaaatcacctggctgcagccaatgca
gctctccttcagcatgcttcagcctgcagtggtggaactaggtgtattttggataaagat
gatatgcttttgtccccggatgtcaatggcgatttcaactctcttggaagtaatgctgca
tcggatgtcagctgggagaacattgacgaaaacgagtccaagatgattcgctgggttcca
gaccatgcggtcactcactgtgccgagtgcgagtcaggctttgggcttctagtcagaaaa
catcactgcaggaactgtggaaacattttttgcgggaattgctcagagaacttcagcatg
attcctcaccagaacttgatgactccggagagagtctgtaatcgctgcttcaacaacctg
cagaggatttccaaacacgtgcgagcatctaacggggtggtcgacgaacgaccgctcgcc
tatgcagcttcaaactag

DBGET integrated database retrieval system