KEGG   Crassostrea gigas (Pacific oyster): 105322181
Entry
105322181         CDS       T03920                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:crg03036]
    105322181
Chromosome and associated proteins [BR:crg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    105322181
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3 DUF4207
Other DBs
NCBI-GeneID: 105322181
NCBI-ProteinID: XP_011419041
UniProt: K1QKJ2
Position
Unknown
AA seq 536 aa
MSSGDKGQVGTESPRPLRKRRTRMANDKRIADDEFMAAAIGDVEWLRQSLREQKGKINFD
KNGLSAIHLAAIHGRLDCLKLLIEKYKVNINLSSTTGWRAIHLCISNQTGKRALQCLQYL
LNKHADPSIPNNDGITPVHQAASEGHVQCLKLLIEIGAKIDGQDIRGHTPLDLAKLWGHK
KCARILAAELWHQDKNNVAKELGQLRKLKMQQVLKEMEEQDEFKAAQEYYGEKAYQEWIQ
KKGLNGKSPTEENKEDLSKSDQPKKGKPVDSLMKPNSKAPPPSGKKSIPDRSNIHVAFRD
DRTPSPQSGRRPADGSEEQGNEDGDKENQVTSSREKSSAPVYVNPEPWRLALHPPKPEYI
TNLTDEYPRDEFTMMPRTKSAHKYFDGKFASRENTDGDLRSKKLKKDIRQPNLPKDVIKQ
GLSKDPTAEQRPVLFKPIHMFDVTMKKKYGDSVKGKSEVSLHLCDDLSSFVYQNSLQRAS
TIDVLSPKSVTSNWLSSRYPRDKVINTIKNMKNPTMFPNIRGEEYDINYGDIATFN
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgtcaagcggagataaaggtcaagtcggtacggagtcaccgcgtcctctgagaaaacga
cgaactcgcatggcgaacgacaaacgaatagcggatgatgagtttatggcagccgccata
ggagatgtagaatggctaagacagagtctaagggaacaaaaaggaaaaataaatttcgat
aaaaacggtttgtcagcgattcacctggcggccatccatggcagactggactgcctgaag
ctgctgatagagaagtataaggtgaatattaatctgtccagtaccacggggtggagagcc
atacacctgtgtatcagtaaccagacaggcaagcgggccctgcagtgtctgcagtacctc
ctcaacaagcacgcagacccatccatacctaacaatgacggtataacaccagtccatcaa
gcggcctcagagggacacgtgcaatgtctcaaacttttgatcgagatcggggcaaaaata
gacggacaggacataagaggccacacccctctagatttggcgaaactgtggggacacaag
aagtgtgccagaatactggctgcagaactgtggcaccaagacaagaacaatgtggccaag
gagttgggacagttacgtaagctgaagatgcagcaggtgctgaaggagatggaagaacag
gacgagttcaaggcggcccaggaatactacggcgagaaggcatatcaggagtggatacag
aaaaagggtctgaatgggaaatcgccaactgaagaaaataaggaagatttgtcaaaatct
gatcagcctaagaaaggaaaaccagttgattcattaatgaagcctaacagcaaagcccca
ccccccagtggtaaaaaaagcattccagataggagcaatattcacgtggcttttcgagat
gacagaactccctctccacaaagtggaagaaggccagctgatggttcggaagaacaagga
aatgaggatggcgataaagaaaaccaggttacatcatccagggagaaatcatctgcccct
gtttatgttaaccctgaaccctggaggctggcacttcatcccccaaaaccggagtatata
accaatctcacagacgaatatccaagggatgagttcaccatgatgccaaggaccaaatct
gcccacaagtatttcgacggaaagtttgccagtagggaaaacactgacggggatttgaga
agtaagaagttgaaaaaagatatacgccagccaaatttaccaaaagatgtcatcaagcaa
gggctgtctaaggatccaacagcggaacaaagaccagtcctgtttaaacccatccacatg
tttgatgtcacaatgaagaagaaatacggggattctgtgaagggaaagagcgaggtctct
ttgcatctgtgtgacgacttatcgtcgtttgtatatcagaacagtctacagagagccagc
actattgacgttttgtccccaaagtccgtcacctcaaattggctcagttccagatatccc
agggacaaagtgataaataccatcaaaaatatgaaaaatcccaccatgttccccaatata
cgaggagaagagtatgacattaattacggagacatcgccacctttaattga

DBGET integrated database retrieval system