KEGG   Crassostrea gigas (Pacific oyster): 105323989Help
Entry
105323989         CDS       T03920                                 

Definition
(RefSeq) dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00790  Folate biosynthesis
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105323989
Enzymes [BR:crg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     105323989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short UCR_TM Epimerase
Motif
Other DBs
NCBI-GeneID: 105323989
NCBI-ProteinID: XP_011421352
UniProt: K1PFL3
Position
Unknown
AA seq 237 aa AA seqDB search
MSCAGRILIYGGKGALGSSCVSLFKSKNYWVGSIDLMPNEQADANVVVKPSESWLNQEDE
VLKGVESIIGGEKLDAVLCVAGGWAGGNAASKEFIKNADMMWKQSVWTSSIAAALAAKYL
KEGGIITLPGAAPCVGGTAGMMGYGMAKAAVHQLVKSLASKGSGLPANSSAVAILPVTLD
TPMNRKFMSEADFTTWTPLEFVAELFFKWTSDGSTRPENGSLVKLVTKEGNTALQNV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcgccggcagaattttaatttatggaggcaaaggagctctaggttcctcctgc
gttagcctgttcaagtctaaaaattactgggttggatccattgatctgatgccaaatgaa
caagcagatgcaaatgttgtggttaaaccaagcgagtcatggcttaaccaagaagacgag
gtcttgaaaggagtagaaagcattatagggggcgagaaactggacgctgttttgtgtgta
gcgggaggatgggccggaggaaatgcagcctctaaagaattcatcaagaatgctgacatg
atgtggaagcagagtgtttggacaagctcaatagcagcagctctggcagctaaatacctg
aaagaagggggaataatcaccctgcctggagctgcaccctgtgtcggtggcacagcaggc
atgatgggatatggaatggccaaggcagctgtacaccagttggtcaagagtctggcctcc
aaaggaagtggactgcctgccaacagctcagcagtggctattctaccagtcactcttgat
acgccaatgaacaggaagttcatgtcagaggctgactttactacatggactccattagag
tttgttgcagagttgttctttaaatggacttctgatggatccactcgcccagagaacggg
agtctggtaaaactggtaaccaaggaagggaacacagcgctccaaaatgtgtaa

DBGET integrated database retrieval system