KEGG   Crassostrea gigas (Pacific oyster): 105324672Help
Entry
105324672         CDS       T03920                                 

Definition
(RefSeq) alpha-1A adrenergic receptor
  KO
K04135  adrenergic receptor alpha-1A
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:crg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105324672
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:crg04030]
    105324672
G protein-coupled receptors [BR:crg04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    105324672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 105324672
NCBI-ProteinID: XP_019921211
Position
Unknown
AA seq 334 aa AA seqDB search
MNDTNDTAEQNPHSGELSLPYAIATGTVLFSILFMTVFGNLLVLLSVAIYKNLRHTTNYF
IVNLACADLLLGLSVLPFSAMLDILGYWPFGPTLCIFWTSVDVLWCTGSIITLCVISVDR
YIGITRPLQHGIIMSERRACWIISLVWIVSLAISIGPVFGWRHDRKLASAQNCHVNREPA
YVLFSVTGSFYIPLFIIVFVYSRIFKTVNEHSKNLQKGETTMSWGKSSTKKVKLRIHTGR
SSCNTILNGNSKQNMSERLIKFSRQKKAAKTLGIVVGVFLLCWFPFFLVLPLGKYSFDND
NFFSIAEKNNDRSVQIKNNFDESMPNLFTINVTI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacacaaatgatacagcggaacagaacccgcattcaggggaactttctctacct
tacgccattgcgacgggaactgtgcttttcagcatattattcatgactgtgtttggaaac
ctgttagtgttactttctgtggccatttacaagaatttgcgacacacgacaaattacttt
attgtgaatttagcctgtgctgaccttctgctggggttgtcagttctgccattttcggcg
atgttggatattcttggatattggccctttggtccgaccctgtgcattttctggacgtcg
gtggatgtgttgtggtgtactggctccataataacactgtgtgtcatcagcgttgaccgt
tatataggaataactcgacctctccaacatggaattatcatgtccgagaggagagcttgc
tggattatttcccttgtgtggattgtctcccttgcgatctctatcggaccggtgtttggt
tggcgacatgaccggaagttagcaagcgctcaaaattgtcatgtgaacagagagcccgcg
tacgttttattttcagtgacgggatcattttatatcccattgttcataattgtcttcgta
tacagccgcatcttcaaaactgtcaacgaacactcaaaaaatcttcagaaaggggagacc
accatgtcttggggaaagtcatccaccaaaaaagtaaagttacgaatccacaccggtcgg
tcgagttgcaacacgatattgaatggaaactcgaaacagaatatgtccgagcgattaata
aaattcagtcggcagaaaaaggccgctaaaacgcttggaatcgtagtcggggtcttcctc
ctttgctggtttcccttctttttggtcctacctttaggtaagtactcttttgataatgac
aattttttttctattgcagaaaaaaataacgataggtctgtgcagattaaaaataatttt
gatgaatcaatgcctaacctctttactataaatgtaactatatag

DBGET integrated database retrieval system