KEGG   Crassostrea gigas (Pacific oyster): 105325462Help
Entry
105325462         CDS       T03920                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:crg04131]
    105325462
Membrane trafficking [BR:crg04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    105325462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 Atx10homo_assoc
Motif
Other DBs
NCBI-GeneID: 105325462
NCBI-ProteinID: XP_011423340
Position
Unknown
AA seq 2155 aa AA seqDB search
MSAAPTQQQRAFAQKLNKQGAAEVRKAVSSTIYSTSDLTRCASGLNLTVPLTDVVDPPDY
EEFVLQNSCTVERDPFRDLILYPEDDVDVHSMPRKCRTVKPIVPELGPEADEFVFDLARR
YTADYTVITRRYHRYSSSVCSKEKLSGQDATIPQEYEVDIEDAQDDEDDINKRQSIHMNS
VPRGSWASSIFDLKSSQGDQLLPHLFDQVSYEQIDEDNRKCRQENREDTLFSLFPGEEEE
DLIERRPSAPFPQEHFGHRIVVKCIQLKLELDFEPLFATVALYDAKEKKKISENFYFDVN
QDEQKKMISMHIQQSDVSTMSRAACFSITYPSPDVFLVIRLEKVLQQGDIGDCAEPYMRE
DKAKEDRLKSNAVQFCERLGKYRMPFAWTAIYLMNIVTGATGGQDAVKTCEPEPSRSSSL
DRRSMSGIPGQFDSFRRRNKEEFSSTRRGSMERGRSERRGLFSGEDYGPSLDNFRPVTLT
VSSFFKQEGDRLSDEDLYKFLADLKRPSSVLKRVKCIPGTLKLDISPCPEEPRYMLTPEL
YKVEPYPDEKTRPTREILEFPSREIYNPHTVYRNLLYVYPRSLNFSNRQGSARNLAVKVQ
FMSGEEEGCALKAIFGKSNCPELSREAYTAVTYHNKSPDFYEEIKVKLPAKLTDAHHLLF
TFYHISCQSKKNESGPVEVPVGYTWLPLCREGKLMIDDFSIPVSVDKLPPSYSILFPDTN
LPNMKWVDHKGLFNVSLRSMSSVHTQDDKLEKFLYNCRMTLEQKLPPRRTESQFENDLRL
SIQDIPKSKGENLVQFLPLVLDRLLYLMVRPPILGGQQVNIGQPAFEGIILVVKRVHELL
CDKNDRNGRNLTLASYIQYCCTLPHPGPLQHCATDPMLGSGYNTLGRPSSLPVSNKNFPR
SSSNPDLNALTPTSPDNEISAILGGTKYLDRTGSMRADDFNQPQMVRNRAKKLVHEELVL
QWLVLSGQNRDHAFAYSWFLFELIIKSMAEHLNKTQKLDTPRQMRFNDKPFVEDIEALMN
LVNKEVTDKYIKEPQIIRSLNISLGFFLHDLLSFMDRGFVFNLIANYCGAIAEKIQTLSD
STTLMLLRLDFLRIVCSHEHYFPLNLPFGTPLTPTSGRAASPTPSIQSTNSMSSYTSTST
LTDRGQFYELTLQYRQQHFLVGLVLSDLKVALDTHNPIIHHKAINVVRNLLYNHDLDLRY
MDTAMKSRLAALYMPIIGIVIEALPQLSDPGLDLRRHTSCPEEEEADKISHSVALEIAGA
TVFAGRVQEYPGGMDEPKSKKSPLTTECTRNLLICFLWVIKNADESVVRQWWSELNVNVL
AQILDVLYFCISNFEYKPKWLKPFRLSAHLAETLFDAPRPKSASLPRSYELLWEGLQRKS
QDLLQRQRSKEDTSQGKKSIAQCSKQTIQKSVDMKSRLEEAILGNLNARTEMMLRRRQTS
YSQMAGDNGQMSSQGDSRLRWRKDQINYKPSLDQTESVKPRNVEADAHTEGSLAAEISMV
ALDTLELIIQIARSMEYTPLQSNALRILLHSLSLNQSTSVLKNMFATQRALVTRFLDMLF
VEETEQCADLCLRLLRHCSSLISQTRSQASASLYMLMRQNYDLDNNFARVKMQVTMSLSK
LVGQNQNFSEESLRRSLKTILTYAEEDADLAETPFTEQVKDLVFNLHMILSDTVKMKEFQ
EDPEMLLDLMYRIAKGYQNSPDLRLTWLHTMATKHSERNNHAEAAHCLVHAAGLIAEYLY
MIEDKPYLPVGAVDFQKISVNVLEESAVSDDVVSPEEGVCTGKYFTENGLVGVLEAAAME
FNMAGMYEHVNEVYKILIPIHESGRDYKKLGAIHNKLHEAFSNITRQEGKRMFGTYFRVG
FYGHKFGDLDGEEFVYKEPPITKLPEVAHRLEGFYSDRFGEGVVHIVKDSNPVDRESLDS
AKAYIQITYVEPYFDLYEYRTKVTYFERNNNIKRFVFATPFTQDGRAHGEIHEQHKRKTI
LTTSHMFPYIKTRLQVISHDQVLLTPIEVAIEDIQKKTKELAVALYQEPPDTKILQMVLQ
GCIGTTVNQGPVEVAVVFLKDSPENKSQDVRHRNKLRLSFKDFLKKCSDALHKNKSLISS
DQKEYQRELERNYHSVRDKLLPYISSNLATLKTKHHRRGNKESPSKHKSSGSSKT
NT seq 6468 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctgcaccgacccagcaacaaagagcttttgcccagaagctaaataaacaagga
gcagccgaagttagaaaggctgtctcctcaaccatctactcaacctctgacctcactcga
tgtgccagcggactcaatctcacggtgcccctaactgatgttgttgatccgccagattat
gaggagtttgtgctccagaactcatgcactgtggagagggacccattccgagacctcatc
ctgtaccccgaggatgatgtggacgtacacagcatgcccaggaaatgtcgcactgtcaaa
cccatagtgccagaactcggacctgaggcggatgagtttgtgtttgacttggcgcggcgt
tacaccgctgactacacagtcatcacccgccgctaccaccgctacagctccagtgtctgc
agcaaggaaaagctgagcggacaggatgccaccatcccccaggagtacgaggtggacata
gaggacgctcaggacgacgaggatgacatcaacaagcggcagtcgatccacatgaactct
gtcccccgggggagttgggccagcagtatatttgacctgaagtcgtcccagggtgaccag
ctgctgcctcacctgtttgaccaggtgtcgtatgaacagatcgacgaagacaacaggaag
tgtcggcaggagaaccgagaggacacactgttcagtctgtttcctggagaggaagaggag
gatctcatagaaagacggccttctgctccgtttccacaggaacactttggtcatcgaatt
gttgttaaatgtattcaactcaaattagaactggactttgaaccattgtttgccactgtg
gccctgtatgatgccaaggaaaagaaaaagatatcagagaatttctactttgacgtgaac
caggatgagcagaagaagatgataagtatgcacatccagcagtcggacgtgtccaccatg
agtcgggccgcttgcttcagcatcacctacccctccccagatgtcttcctcgtcatcagg
ctggaaaaagttttacagcagggagacataggggactgtgcagagccatacatgagagaa
gataaggccaaagaagatcgcttgaaatccaatgctgtacagttctgtgagcgccttggg
aagtacagaatgccatttgcctggacagctatctacctgatgaatattgtcactggggca
actggtggtcaggatgcagtaaaaacctgtgagccggagccttcccgatcctccagcctt
gacaggagatctatgtctggtattcccggtcagtttgacagcttccgtagaaggaacaag
gaagagttctcctctacccgccggggatcgatggagcgtggtcgcagtgagaggaggggg
ctattctcgggggaggactatggacccagtctggacaacttcagaccagtcaccctcact
gtctccagtttcttcaagcaggaaggagacagattaagtgatgaagacttgtataagttt
ttggctgatttgaaacgaccatccagcgtcctgaaaagagtgaagtgtattcctggaacc
ttgaagttagacatttctccttgtcccgaggagcctcgctacatgttaacccctgaactc
tacaaggtggagccttaccctgacgaaaagaccagaccaacgcgtgaaatcctggaattc
ccctccagagaaatatacaacccccacaccgtgtataggaacctgttgtatgtgtacccg
cgtagtctgaactttagcaatagacagggctctgctaggaatctggccgtcaaagtccag
ttcatgtcaggagaggaggaggggtgtgctctcaaggcgatcttcgggaagtctaactgt
ccagagctgtccagggaagcctacacagcggtcacctaccacaacaagtcccccgacttc
tatgaggagatcaaggtcaaactccccgctaagctgaccgacgcccaccatctcctcttc
accttctaccacatcagctgtcaatcaaagaagaatgagtccggcccagtcgaggttcct
gtgggatacacgtggctgccgctctgtcgtgaagggaagctgatgatcgacgacttctcc
atccctgtgtctgtggacaaactcccgcccagctactcaattctcttccctgataccaac
cttcccaacatgaagtgggtggatcacaagggactgttcaatgtcagcctcagatcaatg
tcctcggttcacactcaggatgacaagctggaaaagttcctatacaactgtaggatgacc
ctggaacagaagctcccaccccggaggaccgagtcccagtttgagaatgaccttagactc
agtatacaagacatccccaaatccaagggagagaacttggtgcagttcctgccactggtc
ctggacagactgttgtatctgatggtgaggcccccaatacttggaggacagcaagtaaac
attggccagccagcctttgaaggaataattctggtggttaagagggtccatgaactgttg
tgtgataaaaatgaccgtaacggacggaacctaacactggcctcctacatacagtactgc
tgtaccctaccccaccctggaccattacaacattgtgctacagatcccatgcttggatct
ggatacaacacactcggacgaccgtcatctcttcctgtctccaacaaaaacttcccgcgg
agttccagcaatccagacctgaatgcgctaacacccacctctccagacaacgaaatatct
gccatcttaggaggtacaaagtacttggacaggacagggagcatgagggctgatgatttc
aatcagccacaaatggtcaggaacagagccaaaaagctggttcatgaggagctggttcta
cagtggctggttctgagtggacagaacagggaccatgccttcgcctactcctggttcctg
tttgaactgatcatcaagagcatggcagaacacctgaacaagactcagaagctggacacg
ccccgccagatgaggttcaatgacaaaccgtttgttgaggacattgaggccttgatgaac
ttggtcaacaaagaggtcacagacaagtacatcaaggagcctcagataatccgaagttta
aacatcagcctgggcttcttcctgcacgatctcctcagtttcatggatcgaggatttgtc
ttcaacctcattgcaaactactgcggggctattgcggagaagatccagactctgtctgac
tcgaccactctgatgctattacggctggactttctgcgaatcgtctgtagccacgagcat
tacttccccctcaatctgccattcggaactcctctgacccctacatcagggagagctgcc
agccccacccccagcatccagagcaccaactccatgtcctcctacacctccacctccacc
ctgactgaccggggacagttctatgagctgaccctacagtacagacagcagcacttcctg
gtgggcctagttctgtctgacctgaaagtagccctggatactcacaatcccatcattcat
cataaggccatcaatgttgtacggaacctgttgtacaaccacgaccttgaccttcgatac
atggacactgcaatgaagtcacggctggccgctctgtacatgcccatcattgggatcgtg
atcgaggcactgccacagctcagtgaccccggccttgacctgaggcgacacacaagctgc
cctgaagaggaggaggcagacaaaatcagtcacagtgtcgccctggagatagcaggggcc
accgtttttgctgggagagttcaggaatacccaggagggatggatgaacccaagagcaag
aagagtccactgaccaccgagtgcactcgtaacctgttaatctgtttcctgtgggtcatc
aagaatgcggacgagtccgtggttcgtcagtggtggagtgaactcaatgtgaatgtgctc
gctcagatcctagatgtcctctacttctgtatctcaaactttgagtacaagccaaaatgg
ttaaagcctttccgattatcggctcatctggctgaaactttgttcgatgctccccgccct
aagagcgctagcctgcctagatcttacgaattattatgggaaggccttcagagaaaatcc
caggatttgcttcagcgccaaagaagcaaagaggacacctcacagggaaagaagagcatc
gctcagtgctccaagcaaaccattcagaaaagtgtggacatgaagtctcgcctggaggag
gcaatcctcggaaatttgaacgccaggacagagatgatgttgaggagacggcagacatct
tacagtcaaatggcaggtgataatggccagatgagttcccaaggagacagtagactcaga
tggaggaaggatcagataaactacaaaccttctcttgatcagacagaaagtgtaaagcct
cgcaatgtggaggctgacgctcacactgagggaagtctggccgcagaaatcagcatggtg
gccctggacacactggaactcatcatacagattgctagaagtatggagtacacgccctta
cagagtaatgctttacgtatcctgctccacagtctcagccttaatcagtcaacatctgtc
ctgaaaaacatgtttgccactcagcgggctctagtcacaaggtttctggacatgctgttt
gtggaggagacagagcagtgtgcggatctgtgcctgagactgctgagacactgcagctct
ctgatctcacagacgcggtcccaggccagcgcctccctctacatgctgatgaggcagaac
tacgacctcgacaataactttgcgagggtgaagatgcaggtgaccatgtctctcagtaag
cttgtgggacagaaccagaactttagtgaggagtcgctgcgtcgatctctgaagacgatt
cttacatatgcggaggaggatgcggacctagcagagacaccattcacagaacaggttaag
gacctggtgttcaacctccacatgatcctgtcggacacagtgaagatgaaggagttccag
gaagaccccgagatgttgctggatctgatgtaccgcatcgccaagggttaccagaactcc
cccgatcttcgcctcacgtggctccataccatggccaccaaacacagtgagagaaataac
catgcagaagctgcccattgtcttgttcatgctgctggtctgatagcagagtacctgtat
atgatagaagacaagccatatctacctgtaggggctgtagactttcagaaaatctctgtc
aatgtgttggaggagagtgctgtatcagacgatgtggtgtcccccgaggaaggagtgtgt
actgggaaatacttcacagagaacggactagtgggggtactggaggccgcagccatggag
ttcaacatggctggaatgtatgaacatgtaaatgaagtgtacaagatcctgataccaatc
catgagtcgggcagagactacaagaaactcggtgccattcacaacaaacttcatgaagca
ttcagcaacatcacacgccaggagggtaagcggatgtttgggacatacttcagagtgggg
ttctatggacacaagtttggggatctggacggtgaggagtttgtttacaaggagccaccc
atcaccaagcttccagaggtcgctcacagactagagggtttctacagtgaccgatttgga
gaaggtgtggtccacattgtaaaggactctaaccctgtggaccgggaaagtctggactct
gctaaggcctacatccagatcacttacgtggagccgtattttgacctgtatgagtataga
accaaagtgacatactttgaaaggaataacaacatcaagaggtttgtatttgccacacca
ttcacacaagatgggcgggcacatggtgagatacatgaacaacacaagaggaagaccatt
cttacaaccagccacatgtttccctacataaagactcggctacaggtcatcagtcatgat
caggtactgttaacccctatcgaggttgctatagaggacattcagaagaagacaaaagag
ctggctgtggctctctaccaggaaccacccgacaccaaaattctccagatggtgctacaa
ggctgtatagggaccaccgtaaaccagggtccagtggaggtggctgtggtgtttctaaaa
gacagcccagaaaacaagtcccaagatgtccgccaccgaaataaactccgtctcagcttc
aaggacttcctcaaaaaatgtagtgatgccctccacaagaacaaatctctgatctccagt
gatcagaaggagtaccagcgtgaactggagaggaactaccacagtgtccgggacaaactc
ctcccctacatctcctccaaccttgccacactcaaaacaaagcaccacagacgtggaaac
aaagagtcacccagtaaacacaagtcatcaggatcttccaaaacttag

DBGET integrated database retrieval system