KEGG   Crassostrea gigas (Pacific oyster): 105326487Help
Entry
105326487         CDS       T03920                                 

Definition
(RefSeq) probable Na(+)/H(+) antiporter nhx-9
  KO
K12040  solute carrier family 9 (sodium/hydrogen exchanger), member 3
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:crg02000]
    105326487
Transporters [BR:crg02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   105326487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_H_Exchanger
Motif
Other DBs
NCBI-GeneID: 105326487
NCBI-ProteinID: XP_011424858
UniProt: K1RLJ7
Position
Unknown
AA seq 1027 aa AA seqDB search
MNWKALFGLAISCVLLLAPARILASSEAAAGGHNNGTERYKLVVFDFERVELPLVICLWI
LIVALAKIAFHLNSKLPTVIPESCLLVVMGLVVGALLHFTNIANTDEYVLNADVFFIYLL
PPIIFDAGYFMPVRAFFDNLGTILLLAFINTCISAGLIAACLYGISLLGWFGRTISILDC
FIFSSLISAVDPVAVLSVFEEIHVNQMLYIIVFGESLLNDGVTVVLYHMFEGFIEIGESN
IQSIDIVTGLGSFFIIAIGGTLIGILFGFFGGFITKYTEHVKVIEPLFVFVIGYLMYLTA
EMCHLSSILALSFGGIVLRHYLEANVSRSTRTSIRYFMKMLANISETIIFMFLGLSAIVD
TLDWNLSFIFFALLFCLVFRVLGVMFLSWILNRRRLVKLTGIDQFIMAFGGLRGGIAFCL
ALSLEEELVPEKKLFVTATIVIVFFTVFVQGISIKPVVNALKVKKEGDNDPKMTEKIQES
FIDHIMAGMEGITKHSSHNLMRIKFRHFNHNYLKPLFNKEVPQTKAKKVLEVYHTISVAE
ALDQIGNEVDVNQKKPLVSTGASNVYRRTPSGFVNSGFRGESMANEQLETSNQNESGSVN
TEGSPIIYKCVEDPVVRETVVMERPRTSPPVGGGSNTAEKGTANGEDSEEFENVTITFKQ
PLDNAVGGEQNTEISDFSSESFSYGDTMSEPSTITYANEEETPNTVTPLELPLPWKTPSH
HSNIETHDVVTNSELSNGELPKAMEPVGTAAESFFPWRNFPRDPIPFSTSLAYSDDSAPV
VAEAPTWVNNLSYSHLKESGSPYASPEMTLIPVSRHMHTSVFDVFKTDQIGKCLDACVAK
LQTALDETDSKSHQSGDTLPPPWSHHNDSVDDLPVPSMIDNFGVKNKLLMSNHTAPPPSH
HVILPTVHFSGEGSVSQSHSDDGETPRQLKSLPGSASAPDLPKHFQLIEPMTKSRLHSES
MLEDLDFHDQAVSRVNEWLSATISEEDGIVIPIHVPTPELSSDNDADCSSEGEGDDDEGW
DFDRDDL
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgaattggaaagctttgttcggattagcgatcagctgtgtgctgctgttggcgccggcg
aggatcctagcctcatcagaggcggcggcagggggacacaacaatgggacagaacggtac
aaactggtggtgtttgattttgagagggtggagctacccctagtcatttgtctctggatc
ctgatcgtggcgttagccaaaatagcattccatttgaattcaaagctccctacagtaatt
ccagagagttgtctcctcgttgtcatgggcctcgttgtgggggctcttctccacttcacc
aacattgcaaacacggacgagtatgtcctgaatgcagatgtcttcttcatctaccttctt
cctcccatcatcttcgatgcgggctacttcatgcccgtgcgggcattctttgataacctg
ggcacgatcctattgttggcctttatcaacacctgtatcagtgctggcctcatcgctgcc
tgcctatatggcatctctctcctgggctggttcgggaggactatcagcatcttggactgc
ttcatcttcagcagcctcatttcggctgtggatccagtcgcggtcctctctgtgtttgag
gaaatccatgtgaatcagatgctttacatcattgtgtttggtgaatcactgctgaatgat
ggtgtgactgtggtgctgtaccacatgtttgagggattcattgaaatcggagagtccaac
atccagtccatcgatatagtaacgggactgggttccttcttcatcatcgcgataggagga
acactcatcggcattctctttggtttcttcggaggattcatcaccaagtatacggagcat
gttaaagtcatcgaacctctctttgtgtttgtcatcggttacctaatgtacctcactgct
gaaatgtgtcacttgtccagtatactggcattatcctttggtggcattgtactgcgtcat
tacttggaagccaacgtctcgcgttccactcgcaccagcattcgctacttcatgaaaatg
ttggccaatatcagcgagaccatcatcttcatgttcctagggctgtcggctatagtggac
actctggactggaacctgtctttcatcttctttgcccttctcttctgtctggtattcaga
gtcctaggagtcatgtttttatcgtggatcctaaatcggcgtcgcctggtgaagctgact
ggtattgaccagttcatcatggcctttggcggacttcgaggtggcattgcattctgttta
gcgctctcattggaggaagagctagttccggaaaagaagctctttgtgacggcaaccatt
gtcatcgtatttttcaccgtgtttgtgcagggaatctccattaaacctgttgtaaatgcc
ctcaaagtgaaaaaagaaggggataatgacccaaaaatgacagagaaaattcaagaatct
ttcattgaccatataatggcagggatggagggaattacgaagcattccagtcacaacctg
atgcgtatcaaattccggcattttaatcacaactacctgaagcccctgttcaacaaagaa
gtcccccagacaaaggcaaagaaggtgttggaggtgtaccacacaatcagtgtcgcggaa
gctcttgaccagatcggcaatgaagtggacgtcaaccagaaaaagcctcttgttagcaca
ggggcttcaaatgtgtacagaagaactccgtcgggctttgtaaactcgggtttccgtgga
gagagcatggccaatgaacaactggaaacttcaaatcaaaatgagtctgggtcagtgaac
acagagggatctccaattatatacaagtgtgtggaagatcctgttgtcagggaaacagtg
gtcatggagagacccaggacatccccacctgtgggagggggaagcaatacagcggaaaaa
ggaacagccaatggtgaagatagtgaagaatttgaaaatgtcaccattacattcaaacag
ccattggacaatgcagttggaggggaacagaacacagaaatttctgacttctcatctgag
agtttttcctacggagacactatgtcagaaccatccacgatcacctatgcaaacgaagaa
gaaacaccaaacactgtcacaccattggaacttcccttaccttggaagacaccttcccat
cattccaacattgaaacacatgatgtagtcaccaatagtgaactgtccaatggtgaattg
cctaaggcaatggaaccagtgggcaccgcagctgaatcttttttcccgtggagaaatttc
ccacgggatcctattccgttttccacatcacttgcttactctgatgacagtgccccagtg
gttgcagaggcccctacgtgggtgaataacctctcgtacagtcatctgaaggagtcgggg
tctccctatgcctcacctgaaatgaccttaattccagtgtcccggcacatgcatacatca
gtctttgacgtattcaagacggatcagattggaaagtgtctggatgcctgtgttgctaag
ttacaaactgctttggatgagactgatagcaagagccatcagtctggagatactcttcca
cctccgtggagtcaccataatgacagtgtggatgatcttccagtgccatctatgattgac
aactttggagtcaaaaataaactcctcatgtccaatcatactgcacctcctccatcccat
cacgtcatattacctacagtgcatttctcaggggaaggctctgtctcgcagagtcacagt
gatgatggggaaacccccaggcaattgaaatctctacctggctctgcctcagctcccgat
ctgccaaaacactttcaattgattgagccaatgacgaaatcccgcctccattccgagtcc
atgttggaggatctggacttccatgaccaagcggtatcgcgcgtcaatgaatggctgtcg
gccactatcagcgaagaagacggaatcgttataccgatccatgtccccacccctgagctc
tccagtgacaatgacgcggactgtagcagcgagggggagggggatgatgatgaaggctgg
gactttgatagggatgacttatga

DBGET integrated database retrieval system