KEGG   Crassostrea gigas (Pacific oyster): 105328130Help
Entry
105328130         CDS       T03920                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00071  Fatty acid degradation
crg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105328130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:crg03029]
    105328130
Enzymes [BR:crg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     105328130
Mitochondrial biogenesis [BR:crg03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    105328130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf DUF1839
Motif
Other DBs
NCBI-GeneID: 105328130
NCBI-ProteinID: XP_011427203
Position
Unknown
AA seq 488 aa AA seqDB search
MFSTTRYHTSYSSTSLYTGLKFQISFFPHRIPGEECDTLLTHNSTVSKHIAVFRKGVLYR
CEMYDKNGRLLTPTLIQKQLDWIINDADKHADSYSREEKTVASLTGQERAKWCKIRDRHF
CEGVNRDTMDMIEKAMFCLTLETEIYETMSERGQYLLCKNDGKLWYDKCFNLVSFPDGRM
GCNSEHSYADAPIIAHLLEYNYTAEALGQCGFQKDGSLTPDPEDSQYILSLPTRHIWEIT
PDLRTAIVEAGKFCQMNADDLDLCLRELTVYGKGFMKSCKVSPDAFIQMALQLTYYKNAG
KFALTYESSMTRLYLQGRTETVRSLSNDSVAFVKAFLDKSVPKATTINLLRRACNRHQDA
YRDAMSGQGIDRHLFALYVISKGMGYDCEFLKEALTIPWTLSTSQQPQQQIATSPDCNLP
QYRHALCPGGGFGPVSDDGYGVSYMIPGDHKVFFHVSSKRSTPGTDSVKFMDQLFETFVE
LKELFSKD
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgttctccaccacaaggtatcatacatcttacagttcaacttcattgtacactggttta
aaatttcaaatttccttttttccccacagaattccaggcgaagaatgtgataccttgttg
acccataattccactgtatccaagcacattgctgtgttcaggaagggagttttgtacagg
tgtgaaatgtacgacaaaaacggccgccttctgactccaacactgatccagaaacaactg
gactggatcattaatgatgcagacaaacatgctgactcctactccagggaagagaagaca
gtagccagcctgacgggacaggagagggccaagtggtgtaagatcagggacaggcacttc
tgtgagggggtcaacagggacaccatggacatgatagagaaggccatgttctgtttgacc
ttggagacagagatatatgagacaatgtcagaaagagggcagtaccttctgtgtaagaat
gacggcaagctatggtatgacaagtgttttaatctggtctcattcccggatggacggatg
ggctgtaacagtgaacacagttacgccgacgcccccatcatcgctcacctgttagagtac
aactataccgcagaagcccttggccagtgtgggttccagaaggatgggtccctgacccct
gaccctgaggactctcagtacatcctgtccttgcccaccagacatatatgggagataact
ccggacctgcgaacagccatagtggaagctggaaagttctgtcaaatgaatgctgatgac
cttgacctttgtctaagggagttgactgtttatggaaaagggtttatgaaatcctgtaaa
gtcagtccagatgcctttatacagatggcgctccagttgacctactataagaatgctggg
aagtttgcgctcacctatgagtcatcaatgactcgcctctatctccagggcaggaccgag
acagtgagatctctcagtaacgactctgtcgcatttgtcaaggcatttttggacaagtct
gtaccgaaagcaaccacgatcaaccttttacgtcgcgcctgtaaccgacatcaggacgca
taccgcgacgccatgagtgggcagggcattgacagacacctgtttgctctgtatgtcatc
agcaaagggatgggatatgattgtgagtttctgaaagaagccctgacaattccctggact
ctatccaccagccagcaacctcagcaacagatagcaacttctcctgactgcaacctgccc
cagtacaggcatgctctctgcccaggtggtggttttggcccagtttctgacgacggctat
ggggtgtcctacatgattcctggggatcacaaggtcttcttccatgtgtcctccaagaga
tccaccccgggaacggactcggtcaaattcatggaccagctgttcgagacgtttgtagaa
ctgaaggagttgttcagcaaagattga

DBGET integrated database retrieval system