KEGG   Crassostrea gigas (Pacific oyster): 105328196Help
Entry
105328196         CDS       T03920                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1-like
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00230  Purine metabolism
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105328196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:crg01001]
    105328196
Enzymes [BR:crg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     105328196
Protein kinases [BR:crg01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   105328196
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 105328196
NCBI-ProteinID: XP_011427264
Position
Unknown
AA seq 629 aa AA seqDB search
MSSEYCVKYHKPRNGFDIVDLTQTEILEIVVGTLGGVLVLVVFLSIIIPRFVVRHIKKKA
SESVWRIKETDLIAKKRSNFSMSRISLRSEQIVVDKHLVCTALYKGATVVLKKFEKGDSI
YDVKEFRQIRELDHLNVAKVFGFCMDSLKFVVVAEYCSKGSLMDILENEDINMNWDFRCC
LLWDTIRGLEYIFSSSIRYHGNLKSSNCVIDGRFVLKLTDFGPRKWLEKKSRCDRDLLWT
SPERLRLRVLPSFGHYQQSDIYSLAIVMHELFERTGPFGVETIQIQPYEIIERLRNQTTV
HFRPLFESNNCPGKLQALISKCWDESPECRPTLKELKKNIKITTDVQADNFFDNLLKRME
QYATNLEELVEERTSKYLHEKKRAEDLLYRLLPQSIAHQIQSRGFVEPEAFESVSILFTD
IVQFTSFSAESSPMQIVQMLNELYSTFDDVITAYDVYKVETIGDAYMCASGLPQRNTYHH
TEIAKLTISIMKVVDKFKIRHRPHRKLQLRAGIHSGPCVAGVIGSKMPRYCLFGDTVNTA
SRMESTSEASKIQISSSTATLLRDSPDIDLTTRGEIYIKGKGTMLTHWLEWREQKPKTHV
FSEMAALMESSNAWHSELNGNTLTDVCNH
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagaatactgcgtcaaatatcacaaaccacgtaatggttttgacattgtagat
ttgacccagactgagattctagagatcgtggtcggaacattgggaggagttctagttcta
gtggtgtttcttagcatcatcattccacgctttgttgtaaggcatatcaaaaagaaagca
agcgaaagtgtatggagaattaaggaaaccgacctcatagctaaaaagagatctaatttc
tctatgtctaggatctctctccgttctgagcagattgttgtcgacaaacacctcgtgtgc
acggcgctgtacaagggagcaaccgttgtgctgaaaaaatttgaaaagggcgattccatt
tacgatgtgaaagaattcagacagattcgagaactggaccatttgaacgtagccaaagta
ttcgggttttgcatggattctctcaagtttgttgtggtggcggaatattgcagcaaaggg
agcttaatggatatcttggaaaatgaagatatcaacatgaattgggacttccgttgctgt
ttactctgggatacaattaggggtcttgaatacatcttcagctcaagtattcgttaccat
ggaaatctaaaaagctcgaactgcgtcattgatggccgatttgttctgaaactgacggac
tttggaccccggaaatggctcgagaagaaaagtagatgcgatcgagacttgctttggaca
tcgccagagagacttcgactgagagttcttccttctttcggacactatcaacaatcggac
atctactcgctagccattgtaatgcacgaactgttcgagagaactggtccatttggagtc
gaaacaattcagattcaaccttacgaaatcatagagcggctgaggaaccagacgactgtt
cacttccggcctctgtttgaatccaataattgtccgggaaaactccaagctctgatctca
aagtgttgggacgaaagtcccgaatgtagacctactctgaaagagctgaagaagaacatc
aaaattactacagatgttcaagctgacaacttttttgacaatcttctgaaacgaatggag
caatatgcaacgaatttggaggaattggttgaagagaggacctcgaaatacttacatgag
aagaaaagagccgaggatcttctatatcgactcttgccccaatcaatcgctcatcaaata
cagtctcgaggatttgtagaaccagaagcatttgaatcagttagcattcttttcaccgac
attgtacaatttacgtcattctccgcagaatcatcgccaatgcagattgtgcaaatgttg
aatgaactatattccacttttgatgatgtcatcaccgcatatgacgtctacaaggtggag
acgatcggggacgcctacatgtgtgcttccggtctgccccagaggaacacctaccaccac
acggagatcgccaaactgaccatctccataatgaaggtggtcgacaaattcaaaatccgg
caccggccgcaccggaagttacaactccgtgctggaattcattctggcccctgtgtagcg
ggtgttatcggtagcaaaatgccacgctattgtttatttggggacacagtgaacacagca
tcaaggatggagagcacgagcgaagcatcaaaaattcaaatcagtagttctacggctaca
cttcttcgggactcgccggacatcgatttaactactaggggagagatctatatcaagggc
aagggcaccatgttgacccactggctggaatggagggagcagaaaccaaagacacacgtg
ttctcagaaatggccgcactaatggaatcatcgaacgcgtggcattctgaattaaacggc
aacacgttgactgatgtgtgcaatcattaa

DBGET integrated database retrieval system