KEGG   Crassostrea gigas (Pacific oyster): 105328430Help
Entry
105328430         CDS       T03920                                 

Definition
(RefSeq) uncharacterized protein LOC105328430
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:crg01009]
    105328430
Enzymes [BR:crg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105328430
    3.1.3.48  protein-tyrosine-phosphatase
     105328430
Protein phosphatases and associated proteins [BR:crg01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    105328430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc
Motif
Other DBs
NCBI-GeneID: 105328430
NCBI-ProteinID: XP_011427596
UniProt: K1RB41
Position
Unknown
AA seq 486 aa AA seqDB search
MSTDGHKRLNELPEVSPFIVCTQSSSLSVRKSSDIFITTFDSANTSKLSADQKREQFASR
RPRSLKDIFFRSKNSDKGIPFDKGPSDTKSKFSNIVSKHILPFRFVRNLRSEFKKPERPD
TTSCPNLAQKNGLETLATKPENTIVAPFAGTPDQEYTSSSEQESPEETEIKPFPPSQSFP
KSDYDRSFYNPLHERNPLRVQHLAIPKSNEGSKHSLPVADIFTTSFTHSTAPKTTQSLSK
LQCKSAQELPKSPIVAIKQKLIRSYSDTPPRLSIKPQGSTASLKIPTCLQSKMYRDDCVS
QVLDYLFIGSIEVAYNEPKLCRLKIDSLVDISNLSSAQVPSSKKLHCPCLCGNDSRHFRS
RLIIRVEDDDKEDIEQYFSEINKFIDGARKCGKNVLIFSYHGNSRAPAAAIQYLMSHEGF
LLRQAYNLVKNQRPSVDIKQGFQNTLETLEHRLFPEAKPSLPFSNDYLNIADPQAIKCAW
VDCSDM
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagatggacataagcggctgaatgagctgccggaagtttcgccattcatcgtt
tgtactcaatcatcatcgttatctgttcggaaatcctccgatattttcattactacattt
gattctgcgaacaccagcaaactatcagctgaccagaagcgtgagcagttcgcctcccgg
cgtcctcggtcgctgaaagatatcttctttcggtctaaaaactccgacaagggcattcca
tttgataaaggtccaagtgatacgaagtctaaattctccaacattgtttcaaaacacatc
ctgcctttccgatttgttcgaaatcttcgatctgagtttaagaaaccggaaaggcccgat
accacttcctgtccaaatcttgctcagaaaaacggtttggaaacgcttgccactaagccc
gaaaacactatcgtggccccttttgctggtaccccagatcaagagtatactagttcctct
gaacaagagagccccgaggagacagaaattaaaccctttccaccttcacagtcttttcca
aaaagtgactacgacagatcgttttacaacccactacacgaaagaaaccctctgcgtgtg
caacatcttgccatccctaaaagtaacgaggggtcaaaacatagtctcccggtggccgac
atattcacaacatcttttactcattcaacagcccccaaaacaacccagtcactgtctaaa
cttcagtgcaaaagcgcgcaagaattgccaaaaagcccaattgttgccatcaaacaaaaa
ttgattcgaagctattcggacacacctccgcggttatcgattaaaccacaaggtagcaca
gcttcactgaaaatcccgacttgtctgcaatcgaaaatgtacagggacgattgtgtgtcg
caggtgctagattatctttttataggtagtatcgaggtagcctataacgaaccaaaacta
tgccgcctgaagatcgattcgctggttgacatcagtaacttatcgtctgctcaagtgcct
tcatcgaagaagttacactgtccctgcctttgcggaaatgacagtcgtcacttccggtca
aggcttattattcgtgtggaggatgacgacaaggaagacattgaacaatatttctctgaa
atcaacaagtttattgacggtgctaggaaatgcgggaaaaacgttcttatattcagttac
catggtaattcgcgtgcacctgctgctgctattcagtatcttatgagtcatgaggggttt
ctacttcgccaagcctacaaccttgtcaaaaaccagcgaccgtctgtggacattaagcaa
gggtttcaaaacacattggaaacactggagcatagactattccccgaggctaaaccttcc
cttccgttcagcaacgattatctaaacatcgctgatccgcaggccatcaagtgcgcatgg
gtggactgttccgacatgtga

DBGET integrated database retrieval system