KEGG   Crassostrea gigas (Pacific oyster): 105333171Help
Entry
105333171         CDS       T03920                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00230  Purine metabolism
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105333171
Enzymes [BR:crg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     105333171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 105333171
NCBI-ProteinID: XP_011434317
Position
Unknown
AA seq 612 aa AA seqDB search
MYGFVNYALELLVVRNFGDEAWENIKKEAGLEMDGHFLVRQVYEDAKTYDLVGAASKVLN
LPAADILQYFGKMFFEFCQESGYDKILQVLGGTTRDFLQNLDALHDHLATIYPGMRAPSF
RCTERQEDGALILHYYSERDGLEPIVIGIVKEVAHKLHESEVDVEVIKHKSKDCDHVQFA
ITHRDKQTNEYTSVSTGHHDMFSKKKKISPATFCRAFPFHFMYDRNMVIRQAGSSLQRVI
PQTGSPTCRVDSVFEMVRPHMDFEFNNVLSHINTVYVLRTQAGVLDSDGLYIHTNIAEQN
DISRMRLKGQMIYVPESDMMLFLCSPSVTNLDDLHRKGLYLSDIPLHDATRDLVLLSERF
EADYKLARNLEVLNDQLQQTHRELEDEKAKTDRLMYSILPISVANELRHQRPVPASKHEK
VTLLFSGIVGFSEFCAQHSDAEGAIMIINLLNDVYVKFDDLLKTNPDVYKVETVGDKYMA
VSGLPEPCTEHARCIARLSLGMMDISNHLKDPYGNQIVITIGIHSGEVVTGVIGKRMPRY
CLFGNTVNLTSRTETTGVKGRINVSEYAYRFLNSPENFDPEFHFEHRGCVKMKGKPEPME
CYFMTRKAVVTK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttttgtgaattatgccttggagttgcttgtggtacgcaactttggggacgag
gcttgggaaaacatcaaaaaagaggccggtctagaaatggatggccattttcttgttcgt
caagtgtacgaagatgccaagacatacgatcttgttggcgcagcatccaaggtccttaat
ttaccagcagcagatatcctacagtacttcgggaagatgttcttcgagttttgtcaggaa
tcgggatatgacaaaattctacaagttttaggcggaactacaagagatttcttacaaaac
ctcgacgctctgcatgaccaccttgccaccatttacccgggcatgcgtgctccctccttc
cgctgcacagagagacaggaagatggagcactgatactacactattattcagagcgagac
ggactggaaccgattgtgattggtattgtgaaagaggtagcgcataaacttcacgaatca
gaggtggacgttgaggttatcaagcataagtctaaggactgtgaccatgtacagttcgcc
atcactcaccgagacaaacagacgaatgaatacacatccgtttcaactggccaccatgat
atgttctctaaaaagaagaaaatcagtcccgccacgttttgtcgagccttcccgtttcat
tttatgtatgaccgtaacatggtaataagacaagccgggtcctctttacaacgagttatc
cctcagaccggaagtcccacatgtcgcgtcgactcagtgttcgagatggttcgtccacac
atggactttgagtttaacaatgttctatcacacattaacactgtttacgtgttaaggaca
caagctggggtactggactcagacgggttgtacatacacacaaacattgcggagcaaaat
gacatttctcgcatgcgtctaaagggtcaaatgatatacgttccggaatcggatatgatg
ttgtttttatgttctccaagtgtgacaaatttggacgatttacatagaaagggtctttac
ttgagcgacattcctctgcatgacgctactcgtgacctcgtgctgctgtccgaacggttc
gaggcggactacaaattggcaaggaacctcgaagtactaaacgaccaactacaacaaacc
caccgcgagttagaagatgaaaaagccaaaacagacagattaatgtactctattttgccg
atatctgtggctaacgagctgcgccatcagcgcccggttcctgcctccaagcacgaaaaa
gtcacccttttattcagcggcatcgtaggattcagcgagttctgtgcccagcattcggac
gccgagggggctataatgatcatcaatcttctgaatgatgtctacgtcaagtttgatgat
ctcctaaaaactaatcccgatgtttacaaggtcgaaacagttggtgacaaatacatggct
gtcagcgggcttccggaaccttgcactgagcatgcgcgttgcattgcaagactttctctg
ggtatgatggatatctcgaaccatttgaaagacccatacgggaaccagatagtgataacc
attggcattcactctggggaagttgttacaggagtaattggtaagcgcatgcccagatac
tgtttgttcggaaacactgtgaacctgaccagtcgaacagaaacaacgggggtcaagggc
cggattaatgtgtcagagtatgcctacagatttctcaactcgccggaaaactttgatccc
gagttccacttcgaacacagagggtgtgtaaaaatgaagggtaagccggaaccgatggaa
tgctacttcatgacaagaaaagctgtcgtaacgaaataa

DBGET integrated database retrieval system