KEGG   Crassostrea gigas (Pacific oyster): 105333315Help
Entry
105333315         CDS       T03920                                 

Definition
(RefSeq) probable ATP-dependent RNA helicase DHX58
Organism
crg  Crassostrea gigas (Pacific oyster)
SSDB OrthologParalogGFIT
Motif
Pfam: RIG-I_C CARD_2 ResIII Helicase_C DEAD RIG-I_C-RD CARD SNF2_N AAA_22 AAA_19 TniB UvrD-helicase PhoH AAA_25 Terminase_6 DUF4793 IstB_IS21 Yippee-Mis18 DUF5523 ATP-synt_ab
Motif
Other DBs
NCBI-GeneID: 105333315
NCBI-ProteinID: NP_001292234
UniProt: K1QJL0
AA seq 1018 aa AA seqDB search
MAENEEPKSSLYYMDNIECRLDSIETPALVALYRPLISRCVKVDDVVFYLDDVINTEERE
EIIAIKARKGSTKAMKVLLSFIDRSEANDKWTKFVEILDKKGYQYVAKALRGEKVNSDVY
KKYINLLSPLRMDLVEKINPNDLLDLLESQEKVIEQSDTEHIKAEMENNGPMAGMIVLLD
RIWRKSENWYTSFLKVLCLKEYTYFVERLDRQFALDEETKNTEGSFPVQCVSDEEEYRLA
ESGNFNELFSGDFHGEKPIQAVVNNVGDKDGVEDTEAKSVIETEETEVDTDLKRTYQNAS
AEEQNHVSEEDVQTSLGAFEERQYQNELALPAQRGQNCIIIAPTGSGKTFVAVKIIKHHL
ENREIQREKKIAFVVEKNNLATQQSETINRHVTCKLKVVSGDTMRDEDFKDLAVLLSQFD
VFVITAQMLVNAMDKRNLRIESFSLIIFDECHHCHGGHSFYKTMIPYHDKKLEDPEERII
LPQIVGFTASIGVGKANTQGQVVNHIKTMMANLDADALVSVKENYFELVTKMNTPDNTIL
KIPKRKIDQFGAIIKDLMVKTEDCLALANDKLPDKNALSPPSTKGNEEYTQWLQTSLMDA
GVRADRDLSPFLFTIRKYLEIYNEALIIHSNARASDALCYILQNIQDLQISDTGTEIEIR
AKTLFENVREELNICATDDQKCEENPLLMKLKEIILETHREESNMRGIVFVRTRVVADII
ASWMKETDELKQIKARKYTGAQARGTDGGSTKSKQRETIELFTKGDFKVIVATTIAEEGL
DIEECNLVVKYDYAGNLISQIQAKGRGRAVNSRFFILASENKCVAERELTNSLQEPMMEE
AMNFVQQEIQAENEKYQMEKQELQRQAKRERDAAVHNQSSRTNAQRQCVLRCLKCNQYLC
LSNELKKIGSHFACVSEKLKNHVTCEKSEDIIFENKKIKIGVGIVKCKCGEKIGNVALHR
GIHFPMLQIKAIKIEDDKKELCRLKQWKKVEEEYFTVSPLSTRDFKRISESGKLVDMD
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacgaggaacccaaaagttccctttattacatggacaatatcgagtgccgg
ttagattccatcgagacaccagcgctggtagcactatacagacctcttatttcccgatgt
gtgaaggtcgacgatgttgtgttttaccttgatgacgtcattaacacagaagaacgagag
gaaatcattgcgataaaagcaaggaaaggttcaacgaaggctatgaaagttctcttgtct
ttcattgacagaagcgaagcaaatgataagtggacaaaatttgtagaaatcttagataaa
aaaggctaccagtatgtggcaaaagctcttaggggtgagaaggtaaacagtgatgtatac
aaaaagtatataaatcttctctcacctctaagaatggatctagtggaaaaaataaatcca
aacgatttactggatctgttggaaagtcaagaaaaagtcatcgaacagtcagataccgaa
cacatcaaggctgaaatggaaaacaatggtcctatggccggaatgatagttcttttggac
agaatctggaggaaatctgagaactggtacacctcattccttaaagtattgtgcctaaag
gaatacacatattttgtagagagacttgatagacagttcgctttagatgaggaaacaaaa
aatacagaggggtcatttcctgtccagtgtgtctcagatgaggaggagtatagattagca
gagtcagggaatttcaatgaactgttctctggggacttccatggcgagaaaccaattcaa
gctgttgtaaacaatgttggcgataaagacggcgttgaagacacagaagcaaaatcagtc
attgaaactgaggaaactgaggtcgatacagatttgaaaaggacctaccagaatgcatca
gcggaagaacaaaatcatgtgtctgaagaagatgtgcagactagcttgggagcgtttgaa
gaaagacagtaccagaacgaattggctttgcccgctcagcgaggtcaaaactgtattata
atagccccaacaggaagcggaaaaacatttgtagctgtcaaaataatcaagcatcacctc
gaaaacagagaaattcaaagagagaaaaaaattgcgtttgtggtggaaaaaaataatttg
gccacccaacagtctgagacaatcaaccgtcatgtgacctgtaaattgaaagttgtatct
ggagacaccatgcgtgacgaggatttcaaagaccttgctgttcttctttcgcaatttgat
gtatttgtcataacagcgcagatgctggtaaatgcaatggataaaagaaatttgcgaatt
gaatcattttctctgattatctttgacgaatgtcaccattgtcatggtggtcattccttc
tataaaacgatgattccttaccatgacaagaagctggaagatccagaggaacggatcatt
ctcccccagatagttggattcacagcctctattggagtgggaaaagcgaacacgcaagga
caggttgttaaccatatcaaaacaatgatggctaatttagacgcagatgcactggtgtct
gtaaaagaaaactatttcgaattggttactaagatgaataccccggataacactatcctg
aaaataccaaaaagaaagattgatcaatttggagcgattatcaaagacttaatggtgaaa
acagaagattgtctggcattagcaaatgataaactaccggacaaaaatgcactgagtcct
ccttctaccaagggcaatgaagaatacacccaatggctacagaccagtcttatggatgct
ggagttagggcagatcgtgatcttagccctttcttattcactattagaaaatatttagag
atttacaatgaagcgttaattattcactccaatgccagagcgagtgatgctctatgctat
attctacaaaatattcaggatcttcaaatatcagacacgggcactgaaatcgaaatccgg
gcgaagactctcttcgaaaatgtgagagaagagttaaacatttgtgccacagacgatcaa
aaatgtgaagaaaatccccttctgatgaagcttaaggaaatcattcttgagacacaccga
gaggaaagcaatatgagaggaatagtgttcgtacgcacacgagtggtcgctgacataatt
gcatcatggatgaaagagacagatgaactaaaacaaataaaggccagaaaatacaccggg
gcccaggctcgtgggacagatggaggaagcaccaaaagcaaacaaagggaaacgattgaa
ttattcaccaaaggagactttaaagtgattgtagccacgaccatagcagaagagggtttg
gatatcgaagaatgcaatcttgtagttaaatatgactacgccggaaatttgatatcgcag
atccaagccaaaggaagaggcagggcagtaaacagtaggtttttcattttggcctcggag
aacaagtgtgttgcagagagagaattgacgaattctttacaagaaccaatgatggaagag
gcaatgaattttgttcaacaagaaattcaggctgagaatgaaaaataccaaatggaaaaa
caagagttgcaacgtcaggcaaaaagagaaagagatgcagcagtgcacaatcagagctcg
agaacgaatgcacaacgacaatgtgttctccgatgcttaaaatgtaaccagtatttgtgc
ctttccaacgaattaaagaaaataggatctcactttgcgtgtgtgagcgagaaattaaag
aatcatgtcacttgcgagaaaagtgaagatatcatttttgagaacaagaagattaagata
ggtgtgggcattgtgaagtgtaaatgtggggagaaaattggaaacgtcgctctacacaga
ggtatccattttccaatgctgcaaatcaaagcaattaagatagaagatgataagaaagag
ttatgtcgcctaaaacagtggaagaaggtagaagaagagtatttcactgtcagccccttg
tctacaagagacttcaagaggatttcagagtcgggaaagctggttgatatggactga

DBGET integrated database retrieval system