KEGG   Crassostrea gigas (Pacific oyster): 105333880Help
Entry
105333880         CDS       T03920                                 

Definition
(RefSeq) glutathione S-transferase Y1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00480  Glutathione metabolism
crg00980  Metabolism of xenobiotics by cytochrome P450
crg00982  Drug metabolism - cytochrome P450
crg00983  Drug metabolism - other enzymes
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105333880
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105333880
   00982 Drug metabolism - cytochrome P450
    105333880
   00983 Drug metabolism - other enzymes
    105333880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:crg02000]
    105333880
Enzymes [BR:crg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105333880
Transporters [BR:crg02000]
 Other transporters
  Pores ion channels [TC:1]
   105333880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 105333880
NCBI-ProteinID: XP_011435396
Position
Unknown
AA seq 215 aa AA seqDB search
MPALGYWKIRGLAQPIRLLLNYVGEEFDDVQYEQGDAPEFSRDAWLSVKNTLGLAFPNLP
YYIDGDIKITQSNSILRYIGDKHGLLGKTPKEKVDCDMMVENAMDFRNGVVRLCYNKDYE
KIKEDYFANVKDKLRQFDAFLGDKPWFAGDNITICDFPMYELLDQHKLMKPGILDDYPNL
AKFVERFENLPKIKAYMASDKFMAGPINNKVAGFK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgccggctctagggtactggaaaattagagggctagcccaaccaataagactactgctg
aattatgttggagaagagttcgatgatgtgcaatatgaacaaggcgatgcaccagaattt
agcagagatgcttggctgtctgtcaaaaacactttaggtttagcctttcctaatcttcct
tattacattgatggtgacattaaaattacacaaagtaactccattctgaggtacatcggg
gataaacatggtcttttgggcaaaactccaaaggagaaagtggactgtgacatgatggta
gagaacgccatggatttcaggaatggagtggtccgactgtgctacaataaggattatgaa
aaaatcaaggaagattactttgctaatgttaaggacaagctgagacaatttgacgcgttt
cttggagacaaaccttggtttgctggggacaatataacaatctgtgacttcccaatgtat
gagttactggaccagcacaaactgatgaagcctgggatactagacgattaccccaacctg
gccaagtttgtggagagatttgagaacctcccaaaaatcaaggcctacatggcgtctgat
aaattcatggccggacccatcaacaacaaagttgcagggttcaagtga

DBGET integrated database retrieval system