KEGG   Crassostrea gigas (Pacific oyster): 105336114
Entry
105336114         CDS       T03920                                 

Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 6
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:crg01002]
    105336114
Enzymes [BR:crg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     105336114
Peptidases and inhibitors [BR:crg01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   105336114
SSDB
Motif
Pfam: Pep_M12B_propep Reprolysin TSP1_ADAMTS ADAM_CR_2 ShK TSP_1 ADAM_spacer1 Reprolysin_3 TSP1_spondin Reprolysin_2 Reprolysin_4 TSP1_CCN Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 105336114
NCBI-ProteinID: XP_011438600
Position
Unknown
AA seq 1487 aa
MLNVRIVTSLLSLLVGIAAAGEKFHFTLSEDELSHYFGTTLLEQVPDYEFIPVQFIKEEV
TPESRNITLKAFGQEYRLYLTENKNLLSPDCKISQLYSNGSKESVPCSNTNDSCHYIGRS
ESHPGSVVALSTCDGLHGVISATDHDLYIQPLLKIHKRSSSQQGKHLAIKRSAQRGTIAS
DEQKRMIRRSARRYLETKVVVAPDSHKFHGSDTTRFVTTVMNMAARIFLDPSLGDSKLYL
AMVKITVLAEERSDLKIVEDSGDLLNAFCQWQKKHDPQDQADPRYPDVSILITKTDLVKN
GDKMNVGLGTMGGVCYTDRKCTVNQDSGLDTAYTIVHELGHALGMKHDGDSNQCTPNQYI
MSPYGSTSSDNARWSTCSAQYLRDYLSGVQCLSDIPSRSGSTVRLYDNTGEKPGIIYSAD
AQCSLFFGGTTTSCVRKTHPCRADCINPKTHQCTIVAASFADGTECGGRNWCINGQCVSM
GRSGPRAVDGSWSSWESEWSGCSRSCGGGVTLKKRTCTNPEPRFGGRECPGKSYQAKLCN
LQPCVTSQHNFKEEQCSATNNNPVHGKRYQFVPFTESESDCKLTCRALDDNLVYTRAEAS
EDGTMCRAAGAAFESRCVKGTCEGFGCDGVLGSNAKFDNCGLCNGAGNTCTGHTGKYKEN
NPGGYHAVLTLPVGSTGITIQNKNGFCFMGVKINGRGIFGQNKQKALSGTYGGSRVLIEY
QATPEKIHIIGPTTASVKIEVYQKYDATQFMGVSPDITYSYYTPHGGASSHDFKWAVVTS
QCSATCGTGKQSRTAKCIRISNNAQVEDYKCDLFLKPSEISVYCNIQACPPEWHAFSWET
CSKECGGGTRTRKVQCVTIQRGEFTAVSESRCNAARKPALSGACNTQACEVTDKVNCDDY
QDDICTNPTYAKWSKENCPNYCKLCTQSTTSSPHGQSNTGNTNTQSSNDPCQDKVKCNEY
GDDVCTTHGPWSHQNCARHCKFCQPCSDVLPDCADYGKSACTGDYEKWAKENCKSYCNYC
DAVNATTSTSTAHQGTSHQETNSNGNHVQSSSSNTASSDPCRDVEKCNEYGDDICTNYEP
WARKNCARHCKFCEPCKDALSDCAAYGKKSCSGVYESWARKNCKLFCNYCGGDSGTTTHR
TTKVVTTTPRATTVSTTHVSSTDPCKDVERCEEYGSDVCTAYASWSKINCQRHCKFCQPC
KDAITDCADYGGQACTGGYIPWAKKNCKLYCNFCDTDSTTTTTSTTTTTTTTTPPPTTVV
VSSDPCRDKIDDCDEYGADVCTAYGAWAKTNCQRHCKFCQPCTDKLPDCAGYGRSACRGQ
YLPWARKNCPHYCNLCGSRKKRDLWRAGMNTPEKINTVIRNSADPMGNNEADRLEMDLMH
ADDRNEDILIPNKISDNNDLKAPEMVVESQNLVPSKVHRIPQIVNSIGDVPNEGGGYNLQ
PVEEYSEGRVPAQTNGSETGQVPPGEEVSVLDEVQKLEKLVDDNIKM
NT seq 4461 nt   +upstreamnt  +downstreamnt
atgctcaatgtaaggattgttacatcactactttctctattggtcggcattgcagcggca
ggggagaagtttcattttaccttaagcgaagatgaattgtctcattactttggaaccaca
ttattggaacaagttccggattacgaatttatacctgtgcagtttataaaagaagaagta
acgccggaatctcgtaacatcacgttgaaagctttcggtcaagagtaccgactgtacctt
acagagaacaagaacctcttatctcccgattgtaaaataagccaactctactctaatgga
agcaaagaaagtgttccctgtagtaacacaaatgacagctgccattacattggtcgttcg
gaatcacatccgggttctgttgttgccctaagtacctgtgatggattgcatggtgttatt
agtgctacagatcacgatttgtacatccaacctttgctgaaaatacacaaaagatcgagc
tcacaacaagggaaacatcttgcaattaaacgttctgcacagagaggaacaattgcttcg
gatgaacagaaacgaatgatcagacggtcagcaagacgttacttggagacgaaagtagtc
gtggcccctgatagccataagttccacggcagtgacaccacgagatttgtaacaacagtc
atgaatatggcagcaagaatttttctggatccctccctaggcgacagcaagctgtatttg
gctatggtgaaaataacagttctagcggaggagaggtcggacttgaagatcgtggaagac
tctggcgaccttctgaatgcattttgccaatggcagaagaaacatgacccccaagaccaa
gctgaccctagatacccggatgtatccatacttatcacaaagacagaccttgtgaaaaat
ggggacaagatgaacgtgggtctcggaacaatgggcggggtctgctacacggaccggaag
tgcacggtgaaccaggattccggactcgacacggcctacactatcgtacatgaacttgga
cacgcgttggggatgaaacacgatggcgatagtaaccaatgtactcccaaccagtacatc
atgtccccctacggctccaccagctctgataacgcccggtggtccacgtgcagtgctcag
tacctcagagactacctaagtggggtccagtgcctctctgacatccctagccgctccggg
tccaccgtgaggctgtatgacaacactggggagaaacccggcatcatttactccgcggac
gctcagtgttcattgttctttggtggaacgaccacgtcgtgcgtcagaaaaacacatcct
tgtcgtgcggactgcatcaatcccaaaacacatcagtgcactattgttgcggcatcgttt
gctgacggaacagaatgcggcgggagaaactggtgtattaatggccagtgtgtgtctatg
ggacggagcggaccacgagccgtagacggcagctggtcgagttgggagtcagaatggtcg
ggatgttctaggagttgcgggggcggggtgacactaaagaaaagaacctgcaccaacccg
gaaccgagatttggtgggcgagagtgtccgggaaaatcatatcaagcgaagctttgcaat
cttcagccctgtgtgactagtcaacataatttcaaagaggaacaatgttctgcaacaaac
aacaatccagttcatggaaaaagataccaatttgttccatttacggaaagcgaatctgac
tgtaagctgacgtgtcgggcgttggatgacaacctcgtttatacacgggccgaggcgtca
gaggacgggacgatgtgccgtgcggcaggagcagcgttcgaatctaggtgtgtcaaagga
acatgcgagggttttggttgtgatggcgttttgggatcaaacgcaaagtttgataactgt
ggattatgcaatggagcaggcaacacgtgcacaggccacactggaaaatacaaggaaaac
aaccctggaggataccatgccgtactcacacttccggttggcagtacgggaattacaatc
caaaacaagaatggattttgctttatgggtgtgaaaataaacggacgaggtatattcgga
cagaacaaacagaaggcgttgtcgggaacgtacggtggatcgagggtactgatagaatac
caggcaacacccgagaaaatccatattattggaccaacaacagcaagcgtgaagattgaa
gtgtatcaaaaatacgacgccacacaattcatgggagtgtcaccagatataacatactct
tattacacaccacatggtggcgcgtccagtcatgacttcaaatgggctgtggtcaccagc
caatgcagtgccacgtgtggaacaggaaaacagtcaagaaccgccaaatgcatcaggatc
agcaacaacgcgcaagtggaggattacaagtgtgacctgttcctgaaaccctcagaaatc
tctgtgtactgcaacatccaagcctgtcccccagagtggcatgctttttcatgggaaact
tgcagcaaggaatgtggtggcggaactcgcacacggaaagtgcagtgtgtaaccatacag
cgaggggaattcaccgcggtgtcggaaagccggtgtaacgccgcgaggaaacctgctctc
agcggagcctgtaatacgcaggcttgtgaggtcactgacaaagtcaactgcgacgattat
caagacgatatttgtacaaacccaacgtatgcaaaatggtccaaagaaaactgtccaaac
tattgcaaattgtgcacacagagcaccaccagtagcccgcatggacaatccaacaccggt
aatactaacacacagtcgtccaatgacccctgccaagacaaggtcaaatgcaatgaatat
ggcgatgacgtatgcacgactcacggaccatggtcccaccaaaactgtgctcggcattgc
aaattttgtcaaccatgcagtgacgtgttacccgattgtgctgattacgggaagagtgct
tgtactggagactatgagaaatgggccaaagaaaactgtaaatcgtactgtaactactgc
gacgctgtaaatgcaaccacaagcactagcactgcacatcaagggacttcacatcaagaa
accaatagcaacggcaaccatgtccaatcgtcttcctctaacaccgctagcagcgacccc
tgtcgggatgtagagaaatgcaacgaatatggggatgatatttgtactaattatgagcct
tgggcaaggaagaactgcgcgcgtcactgcaagttctgtgaaccatgcaaagatgctttg
tctgactgtgccgcttatggaaaaaaatcctgttcaggtgtttacgagtcgtgggccaga
aagaattgcaaattgttctgtaactactgtggaggcgattccggtacaactacacataga
actactaaggtggtcactactacacctcgagcaactactgtgagtacaactcacgtctcc
agtaccgatccctgtaaggacgttgaacgatgcgaggagtacggaagtgacgtatgcact
gcttacgcttcttggtccaagatcaactgtcaacgtcattgcaaattctgccaaccttgt
aaagatgcgatcacagactgtgcagactacggaggacaggcgtgtacggggggttatata
ccatgggccaaaaagaactgcaagctttattgtaacttctgtgatactgatagcacgacg
accacaacgtctaccaccacaaccaccacgacaacgacgccaccaccgactacagtggtg
gtcagcagcgatccgtgtcgcgacaaaatcgacgactgtgacgaatacggggctgacgtt
tgcacagcgtacggtgcatgggccaaaaccaactgtcaacgtcactgcaaattctgccaa
ccatgtaccgataaactgcctgattgtgcaggttacggaaggagcgcttgtagggggcag
tatcttccctgggcacgaaagaattgcccacactactgcaatttgtgtggctcgaggaaa
aagcgtgatttgtggagagccggaatgaatacaccagagaaaataaatacagtaatcaga
aacagcgccgacccaatggggaataacgaagcagaccgtttagaaatggatttgatgcat
gcagatgacagaaacgaagatattttaattccgaataaaatttcggacaacaacgatttg
aaagcacccgaaatggtggtagaatctcagaatctggtcccgtccaaagtccaccgcatt
cctcaaatcgtaaactcaataggggatgttccgaacgaagggggagggtacaatctccag
cctgtagaggaatattcggaggggcgtgtccccgctcagacaaacggaagtgaaacaggg
caggtcccaccaggagaggaagtcagtgtgcttgatgaagttcaaaaacttgagaagctg
gtggacgataacataaaaatg

DBGET integrated database retrieval system