KEGG   Crassostrea gigas (Pacific oyster): 105336206Help
Entry
105336206         CDS       T03920                                 

Definition
(RefSeq) uncharacterized protein LOC105336206
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00511  Other glycan degradation
crg00520  Amino sugar and nucleotide sugar metabolism
crg00531  Glycosaminoglycan degradation
crg00603  Glycosphingolipid biosynthesis - globo and isoglobo series
crg00604  Glycosphingolipid biosynthesis - ganglio series
crg01100  Metabolic pathways
crg04142  Lysosome
Module
crg_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    105336206
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    105336206
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    105336206
   00604 Glycosphingolipid biosynthesis - ganglio series
    105336206
   00511 Other glycan degradation
    105336206
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105336206
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:crg03110]
    105336206
Enzymes [BR:crg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     105336206
Chaperones and folding catalysts [BR:crg03110]
 Intramolecular chaperones
  Others
   105336206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX_C CHB_HEX Glyco_hydro_20b Glycohydro_20b2 GldH_lipo
Motif
Other DBs
NCBI-GeneID: 105336206
NCBI-ProteinID: XP_011438737
Position
Unknown
AA seq 1361 aa AA seqDB search
MHVDVARNFRPKSDIIRLMDGMAMYKMNKLHLHLSDDEGWRIEIPGLPELTEVSGKRCHD
LTERKCLVPQLGSGADTSTSGSGYYTVSDYKDIIKEAQRRHIEVIPEKDTPGHFRAAIKA
MEARFLKYEKENITAAKEYRLVESGDSSKYSSVQMFNDNALNPCIDSTYLFYEKVITEIR
KMHVGLTFFHFGGDEVADGVWLNSTKCRHLAYSRNFTEPISVHLKKYYVHRVANISHRLG
LNLAGWEDGFVDEKGIPYNRMSLPNKEVYTNAWQNIWEWGSAKRAYILANNDYKVVMSQA
THLYFDSPPEPDPEEPGLYWASRFIDTMKTFQFLPDRLYENIDANRFGEPLTNTDVCGQR
NEQYPALIKRNNIIGIQGHIWSETIMTSGIFDYMLFPRILSVAERAWHKASWEDLNTPER
TQTSFADWEEFANTIAYKELDRLQSLGIKYRIPLPGAIKINGTFHANTEFPGHIVQYSYD
EGVTWFDVFDGFHPKRNTILLRSSTQNRERVSRPIPFHLDEPVPLSVQHQVDYLAENIVI
SYNVVSNIETNQTFTANVTIINKGKEDIFYGNWEIYFFSTHLIQPDSYPYPKGYLLPNCD
MKVFHVAGSLFKLKPERQFHLSNKNGVTCTLKAQGYQVARSDSMPNWYVAAEGMQAKEIL
FTRNETLLFVGPLNQPEQYLRFQGDVLSPFTPEERFQINDATNEKDTEPKHVIPTPVHIH
FNNRSIIIDDTWVMHVSTDFPNESMLIADLLNISTSLRKTSIKYIELQKLSHVHILDNNR
TRDEAYEINASPHAITISAQTSKGAFYAYKTLAFLKETRNGSNHLPVFTIRDQPRFPYRG
LHLDVSRNFQPKKEIYKLLEVLSMYKLNTLHFHLTDDEGWRLEIPGIPELTAVGSTRCHD
PQEEECVVPQLGSGASKTAYGSGYYTINDYKAILRYANDRHIRVIPEISLPIHTRAAKRA
MEVRYRKYMDYGNKSAAHKFLLTDFEDKTEYLTMQMFKDNAINICMNSTYEFIRHVVRSI
KDMHVDIQPLRTLHIGGDGMADVWSNSSECQAQRIVNGVNDTHQLRQKFVSKVSKILDDE
SLSMAVFEDVLSNENTLLNVTEISPKRDVMVLNWNNICEWGNGESAYKLANAGYNVVIGH
ATHLYLDHTHEPDPKERGASWASRYIDTRKIFGFVPSNIYYNPDQDSNNKPFTQIDICPS
NGICTTLKRPENIIGMQAQVWTEAMRTVEELHEMIFPRLLGVAERAWHEGLWEKTEDKVE
RIRKTNEEWTSFSAALTKEFMRLDKMGVMYRLPPPGARLINGAVRVNTAFPGMHVEFSLD
NEQTWSVVTTDMIIVGKEDVHFRTRSADGSRFSRVVTIKGN
NT seq 4086 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtagatgtcgctcggaacttccgcccaaaatccgatatcattcgcttgatggac
ggaatggctatgtacaaaatgaataaacttcatttacatctgagtgatgatgaagggtgg
aggattgaaattcccggattaccagaacttacagaagtttcaggaaaaagatgtcatgac
ctcacagaaagaaaatgcttagtgccgcaacttggttctggtgcagatacatctacatct
ggttcaggatattacactgtgtcagactacaaggacattataaaggaagctcaaagacgc
catattgaagtcataccggaaaaagacacacctggtcacttccgcgccgcaattaaagct
atggaagcgaggtttttgaagtatgaaaaggaaaatattaccgcagccaaagagtaccga
ctagtcgaaagtggtgactcaagcaagtattcatctgttcaaatgtttaatgacaacgct
ttgaatccatgtattgactcgacatatttgttctatgaaaaagtaataacagaaatccga
aagatgcacgttgggttgactttctttcattttgggggcgatgaagtagccgatggagtt
tggttaaattctacaaaatgtcgccatttggcttactccagaaatttcaccgagccgata
tcagttcatttgaaaaaatattatgtccaccgtgtcgcaaatatttctcatcgcctgggt
cttaatcttgctggatgggaagatggttttgttgatgaaaaaggaatcccctacaaccga
atgtctttaccaaataaagaagtatacacaaatgcttggcaaaatatctgggaatgggga
agtgcaaagagggcatacatacttgcaaacaatgattataaggttgtaatgtcacaggca
actcatctgtattttgattcgccacctgagcctgacccagaagagcctggactttattgg
gcctcacggttcatagacaccatgaaaacatttcagtttcttccagataggttgtatgaa
aacatcgatgctaatcggtttggcgagccactaacaaacacagacgtgtgtgggcaaaga
aatgaacaatatcccgcattaataaagagaaacaacattattggtatacaaggtcatata
tggagcgaaacgataatgacgtcaggaatttttgactatatgctgtttcccagaatttta
tctgtagcggagagagcttggcataaagcatcatgggaagacttaaatacaccagaaaga
actcaaacctcattcgcagactgggaggaatttgctaacacaatagcttacaaagaacta
gatcgacttcagagtttggggataaagtacagaattcctctacctggagctataaagata
aatggcaccttccatgccaacacagagtttccaggtcacattgttcaatacagttatgac
gagggtgtaacttggtttgatgtttttgacggattccatccaaaacgaaatacgatattg
cttcgttcaagtactcaaaacagagaacgcgtcagcaggccaatcccatttcatttggac
gagcctgtgccattatcagtccagcatcaggttgattacttagctgaaaacattgtgatt
agttacaacgttgtaagcaacatagaaacaaaccaaacttttacggcgaacgttacgata
ataaacaaagggaaggaagacattttctatggaaactgggaaatatacttcttttcaaca
catcttattcaacctgatagttacccttatccgaaaggatatcttctgccaaactgcgac
atgaaagtgtttcatgttgccggatctttatttaaattaaaaccagaaaggcaatttcac
ttgtccaataaaaatggtgtaacatgtacattaaaagcacagggttaccaggtagcaagg
agtgactccatgcccaattggtacgttgcagccgaaggtatgcaagccaaagaaatcttg
ttcacgaggaacgagacattgctttttgtagggcctttaaatcaaccagaacagtatcta
cgttttcaaggagacgtcctttctccatttacaccggaagaaagatttcaaattaatgac
gccacaaacgagaaagacactgagcccaaacatgtcattcctaccccggtgcacatacat
ttcaacaacaggagtataataattgatgacacgtgggtgatgcatgtatcgactgatttc
cctaacgaatcaatgttgattgcagatttattaaacatcagcaccagcttaagaaagaca
tcgataaaatatattgaacttcaaaagttatcgcatgtgcatattcttgataacaaccgc
actagagacgaagcgtatgaaataaatgcatcgccccacgccatcacaatttcagcccaa
acaagtaaaggagcattttacgcctacaagacgctagcatttttaaaagaaacccgcaat
ggatcaaaccatcttccagtatttacaataagagaccagcctcgatttccataccgagga
ctgcatctcgatgtcagcaggaattttcaaccgaaaaaagaaatttacaagctcttggaa
gtcctgtctatgtacaagttgaacacacttcactttcacctgacggatgatgaaggatgg
cgccttgagatcccggggattcctgagttgacagcggtgggttcaacaagatgccacgat
ccccaagaggaggagtgcgttgttcctcaacttggatcaggggcgtctaaaactgcgtat
ggttccggttattatacaatcaacgattataaagctatcctcagatatgccaacgatcgt
catattcgcgttataccggaaatatcgctaccaattcatacacgtgcagcgaaaagggca
atggaagtccgataccggaagtacatggactatgggaataaatccgctgctcataagttc
cttttgacggattttgaggataaaacggagtatctgacaatgcagatgtttaaggataac
gccattaatatatgcatgaattcaacatatgaatttattcgccacgtagttagatctatc
aaagatatgcatgtcgacattcaacccctgcggacgctacatataggaggtgatggaatg
gctgatgtttggtccaactcttctgaatgtcaagcccaaaggatagtcaatggtgtaaat
gacacccaccaattacgacaaaaatttgtctctaaagtttcaaagatattagatgacgag
agtttaagtatggctgtctttgaagacgttctgagtaatgaaaatacactattgaatgtg
accgaaatatcccctaaaagagatgtgatggttttgaattggaacaatatttgtgaatgg
ggcaacggagagagtgcttataagctggctaatgcaggttacaatgtcgtaatcgggcac
gcgactcacctatatctggaccatacacacgagcccgacccaaaagaacgcggtgcctcc
tgggcatcgcgatacatagacactcggaaaatattcggctttgtaccttcaaatatatac
tacaatcctgatcaagactccaataacaaaccattcacacaaattgacatttgtccttca
aatgggatatgtacaacattaaagagaccagaaaatatcatcggtatgcaagcgcaagtt
tggacagaggcaatgcggaccgttgaagaacttcatgaaatgatttttccaagactgctg
ggcgtagctgaacgcgcgtggcatgagggattgtgggaaaaaacagaagataaagtggag
agaatccgcaaaactaatgaagaatggacctcgttttcagcggctttgacaaaagagttc
atgagattggacaaaatgggggtcatgtacagattacctcctccaggggcaaggttgata
aatggagctgttagagtgaatacggcgtttccggggatgcatgtagaattcagtcttgat
aatgaacaaacatggtctgtggtaacgacagacatgataattgtgggaaaagaagacgta
cactttcgaacgaggtctgctgatgggtcacgttttagccgagttgtaactatcaaagga
aattaa

DBGET integrated database retrieval system