KEGG   Crassostrea gigas (Pacific oyster): 105336484Help
Entry
105336484         CDS       T03920                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00010  Glycolysis / Gluconeogenesis
crg00562  Inositol phosphate metabolism
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105336484
   00562 Inositol phosphate metabolism
    105336484
Enzymes [BR:crg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105336484
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105336484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105336484
NCBI-ProteinID: XP_011439132
Position
Unknown
AA seq 467 aa AA seqDB search
MSAFLRLKLSQMIMMIFVFYLMILECLSPAHALSSFRTPSYSTKTPYFWVNDEKETIALD
SETWFEYGEKTCQIIHLNAVFRHGARFPSLKWIKRMTTLHQKLVENGVDERYPFLKAWKN
PFPEKSDKIIAELGEQEQEMLGERFAHRFNLLFDEDMDSIRVVSSSKQRSYASSLSFYTG
LSQTVFGEADKTMEPTVNDIEMRFHDNCVHFAESVDKNKTATNEYSKFKYGPEVDVIAKK
LTDVLHLPEKAAVTPDDLNTIHQLCAFEEALTDAGSEWCQFLDQESLEVIQYMNDLKQYW
KKMYGHDISSAMSCPLLSRIFTTLDKVIQANNADDDYAAAEFGFGHAETLAPLYASLGLF
KDEPQLKADNFKLHLNRKFRASRVLPFSANFAMALYQCDSGEDNNDYLEYVVKFYVNEKT
VDIPACGKQVCPYKEVREFYKNQVDNCEFHKMCRNPEPKENSEHDEL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgttcttgaggctgaaactgtctcagatgataatgatgatatttgttttttat
ttaatgattttagaatgtttgagcccagctcatgctttatcatcgtttaggacgcctagc
tattctacaaagactccgtacttctgggttaacgacgaaaaggaaactatagctcttgat
tctgagacgtggtttgagtatggtgaaaagacatgccaaattattcatttaaacgctgtc
tttcgccacggtgctaggtttcctagtctgaaatggatcaaaagaatgactactctgcat
caaaagttagtagaaaatggcgtagacgaacgatatccttttctaaaggcttggaaaaac
ccctttcctgagaagagtgataaaatcatagctgaattaggcgaacaagaacaagaaatg
ttgggcgaaaggtttgctcacagatttaatttactatttgatgaagacatggatagtatt
cgagttgtgtcttctagtaaacaaagaagctatgctagcagtctatcattttacactgga
ttgtcacaaactgtttttggggaagcagacaagacaatggaaccaacagtaaacgatatt
gagatgagatttcatgacaattgtgttcattttgctgaatctgtagacaaaaataaaacg
gcaaccaatgaatactcaaaatttaaatatggaccagaagtagatgtgattgccaagaag
ctgacagatgttctacatttacccgagaaggctgctgttacaccagatgatctgaataca
attcaccagttgtgtgcttttgaggaggctttgactgacgcagggtcagagtggtgtcag
tttctggaccaggaaagtctggaggtcatccagtacatgaacgacctgaagcaatattgg
aaaaagatgtacgggcatgacatttcttctgccatgagttgtcctctcttgagtcgtatt
tttaccacactggataaagtgattcaggccaacaatgctgatgatgactatgccgcggct
gagtttggatttggtcatgcggagactctggctcctctctatgcttctctcggacttttt
aaagatgagccacagctaaaggcagacaatttcaagctccacctcaacaggaagttccgt
gccagcagagtgctgccgttctcagctaatttcgccatggcgttgtaccagtgcgactca
ggagaagacaacaatgactacctagagtatgttgtcaagttttatgtaaacgaaaaaaca
gtagacattccagcatgtgggaaacaagtgtgtccttataaggaagtcagggagttctac
aagaatcaagtggataactgcgagttccacaaaatgtgtagaaaccctgagccaaaagaa
aattcagagcacgatgagctataa

DBGET integrated database retrieval system