KEGG   Crassostrea gigas (Pacific oyster): 105337152Help
Entry
105337152         CDS       T03920                                 

Definition
(RefSeq) uncharacterized protein LOC105337152 isoform X1
  KO
K23310  PHD finger protein 6
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:crg03000]
    105337152
   03009 Ribosome biogenesis [BR:crg03009]
    105337152
   03036 Chromosome and associated proteins [BR:crg03036]
    105337152
Transcription factors [BR:crg03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    105337152
Ribosome biogenesis [BR:crg03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   105337152
Chromosome and associated proteins [BR:crg03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    105337152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 105337152
NCBI-ProteinID: XP_011440048
Position
Unknown
AA seq 873 aa AA seqDB search
MEAEKDIKCGFCHLGVEAEPVCGKLHVHHDNKNTSAHQKCMQYSADLVQYKFTSFGGFKI
DKVEKEIRRGKRLKCSICKTDRSRQGKWLGATSGCAISNCSKTFHYYCAKRDGVAITKRM
EVRYLKENSTIIMYRVFCGPDHYEQFKSNKGALKKQHLVRNCSDEEQGSDDEDNAVHAEP
DSLNTQYDDDILMISQLSPEKDMDEEMSTTSEKGDAIRKSARKGKKIELKESVSPIVQNV
PDGKQKTKTSPLKEKLSLNKQYSEEDDEIDQISEISGNENNLQNVNDSSDSELEDPFHSK
ALDVSVRLTDIRGDRRLMNMSRNPSPELEDSDTIEIENNSVLKQKEKAKKSNVEVVNKKT
DVNVKKGNQEAATQQRTQVTKNGNKKTRAAENQTFSTPKNNSRGNNKTSNGAQRSITAEL
HITTSPSSIDEVNTEDQATSNVQGYSSDDEMVQQTNVFKNSCNSRDKSSPQVLPHTPGIS
SESEWEETAKFPTCALAISSTTKVSPTKKIMITQEAKDSFDVQNVAIWTSSESFSDQLTD
DHLPHFMKIITDMVRERQFKKLGNLLTDTSCQLNQMESIKHLLNLPEQIVNKIRSSLLSD
VRNEKANGEEVLFMDAKLNTLFLKLNDTVDRTCKIRNRLLPNAKELLGHLYEWTDATTVS
TTPLSQSDTETEWKGICDWMNREGWNQCDSYIYPSDEIFLASKENQGIDRLIQNQTAWEG
QTLNKKVFFMKEMKDFVNSIMFLQELIRSACADTKHSLIICPVTQNISKESLVPADLGKE
TVVQIMSAFKPSIKRGTSIIVISLSNQISRRKTAVVFFEGQTSAPSCENEITVCQVVVPV
RSDRKRRAVATKSTTPQQKRKKIIEICFKNHQH
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagaaaaagatataaagtgtggcttttgtcaccttggagttgaagcggaacca
gtttgtggcaaactacatgtacatcatgacaacaaaaatacttcggcccatcaaaagtgc
atgcaatattcagctgatcttgtgcagtacaagtttacaagttttggaggatttaaaatt
gacaaagttgaaaaagagatacgcagaggcaaaagattgaaatgttctatttgcaagact
gacaggagtagacagggaaagtggcttggtgctacatcaggttgtgctatatctaattgt
tctaaaaccttccactactactgtgccaagcgggatggtgtggccatcacaaagcgcatg
gaagtcagatatcttaaggagaactccaccattatcatgtacagagtgttctgtggtcct
gaccattatgagcaatttaaaagtaataaaggtgcattaaaaaaacagcatttagtaaga
aattgttctgatgaagagcaaggaagtgatgatgaagataatgcagtacatgcagaacca
gacagccttaacacacagtatgatgatgatattttgatgataagccagctgtcaccagaa
aaagacatggatgaggaaatgtccactaccagcgaaaaaggggatgcaattaggaagtct
gctagaaaaggcaagaaaatagaattaaaagagtctgtttctcccattgttcaaaatgtg
cctgatggtaaacagaaaaccaaaactagccctttgaaagaaaagctaagtcttaacaaa
caatattccgaagaagatgacgagatcgatcaaatttcagaaatcagtgggaatgagaat
aatttgcaaaatgtgaatgactctagtgattctgagctggaagatccatttcatagcaag
gcattagatgtaagtgtcaggctgacggacattagaggtgacaggcgtctaatgaatatg
tcacggaacccaagtcccgaactggaggattcagacacaattgaaattgaaaataacagt
gtactaaaacaaaaagagaaagccaaaaaaagtaatgttgaggttgtgaataaaaaaaca
gatgttaatgttaagaaaggaaatcaggaggcagctacacaacagaggacacaggtcaca
aaaaatggaaacaaaaaaacccgagcagcagaaaatcaaacattttcaacaccaaagaac
aattcccgcggaaacaacaaaacctcaaatggagcccagagatccatcacagctgagcta
cacatcacaacatccccgtcttccattgatgaagttaacacagaagaccaggctactagt
aatgtccaggggtatagttctgatgatgaaatggttcaacagacaaatgtcttcaagaac
tcgtgtaatagcagagacaagagtagtccacaagtcctcccccacacaccagggataagt
tcagagtcggaatgggaagaaacggccaaatttcccacgtgtgctttagcaattagcagt
acaaccaaagtctcgccaaccaaaaagatcatgataacccaagaggccaaggacagcttt
gatgtgcagaatgttgctatctggaccagttcagaaagcttttcagatcaactgaccgat
gaccatcttcctcatttcatgaaaattattacagatatggtcagggagagacagtttaag
aagcttgggaatttgttgacagataccagttgtcagcttaatcaaatggaatcaattaaa
catctgcttaaccttccggaacaaattgtgaacaaaatcaggtcctcattactgagtgat
gtaaggaatgaaaaggccaatggagaagaggtcctcttcatggatgccaaattaaatact
ctgtttttaaagttgaacgatacggtggacagaacatgcaagatacggaacagacttctt
ccaaatgccaaagaattattgggccacctgtatgaatggacagatgctacaactgtgtcg
actacccctttgagccaatcagacactgaaactgaatggaaaggaatctgtgattggatg
aatcgggaaggttggaaccaatgtgattcatacatttacccatcagatgaaatttttctt
gcatccaaggaaaaccagggtatagatagattaatacagaatcagactgcatgggaaggc
cagacccttaataagaaggtgtttttcatgaaagaaatgaaagactttgtaaatagcatc
atgtttcttcaagaactgattcgttctgcttgtgctgacactaaacactccctcataatt
tgtcctgtgactcaaaacatcagcaaagagtctcttgttccagcagatcttgggaaagaa
accgttgttcagattatgagtgccttcaaaccatccattaagagaggtacatccattatt
gtcatcagtctgagtaatcaaatttcaaggaggaagactgcagttgtattttttgaaggt
cagacgtcagcaccttcttgtgaaaatgagattactgtctgtcaagtggtagtaccggtg
aggagtgatcgaaaacggagagcagtagctacaaaatccaccacaccacaacagaaacgc
aaaaaaataattgaaatctgttttaaaaaccatcaacactaa

DBGET integrated database retrieval system