KEGG   Crassostrea gigas (Pacific oyster): 105337802Help
Entry
105337802         CDS       T03920                                 

Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00561  Glycerolipid metabolism
crg01100  Metabolic pathways
Module
crg_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    105337802
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:crg01002]
    105337802
Enzymes [BR:crg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105337802
Peptidases [BR:crg01002]
 Serine Peptidases
  Family S33
   105337802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_2 Peptidase_S9 Esterase Lipase_3 PAF-AH_p_II DUF2920 Acyl_transf_2 Thioesterase PGAP1 DLH LIP
Motif
Other DBs
NCBI-GeneID: 105337802
NCBI-ProteinID: XP_011441010
Position
Unknown
AA seq 289 aa AA seqDB search
MALKYGNKCYDRFGDGPLLWTGKWTEMELDDQEKTRTALLFISHGLGEHFDYYDELGYFL
VNSGFRVFTHDHIGHGTSSGTHSHVGNFKEYTKLIFDHCDEMKKNYPDLPIFLFGHSIGG
AAALLAALEKPEYFKGVIISSPFVIPPKVFSSSVEMFYFKNIGARMFPQQELSHIDPNEL
SRDPKKVDRIKNDPLFHAAFKAGLWKAWLDCAAKLQKNFSSIKVSLLVLHGEADKIGDIK
FSQTLYDEAQSQDKELKIYPGCLHNPILELEEDRKQVLEDIKQWLEKRI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttaaatatgggaacaaatgttacgataggtttggagatggaccactattatgg
accgggaaatggacggaaatggaattggatgaccaagaaaaaacaaggacagctttgctg
tttatttcccatggacttggggaacactttgattattacgatgagcttggatattttctg
gtgaattctggctttcgagttttcacacacgatcacatcggccatgggactagttccgga
acacacagtcatgttggaaactttaaggaatataccaaattaatctttgaccattgcgac
gaaatgaagaaaaactaccccgatttaccaatatttctgtttggacattcaataggcggc
gctgcagctttattagcagctctagaaaaaccagaatatttcaaaggcgtcatcatttca
agtccttttgtcattcctcccaaagttttttcgtccagtgtagagatgttttactttaaa
aatatcggagcacgtatgttccctcaacaagaactttctcacatcgacccgaacgagttg
tcacgtgatcccaagaaagtggacagaattaaaaatgacccgctgttccacgcggcgttc
aaagcaggactctggaaagcttggcttgattgtgctgcaaaactgcaaaaaaatttcagt
tcgataaaagtgtcattactcgttctccatggagaagctgacaaaattggcgatataaag
ttctcccaaactctgtatgacgaggctcagagtcaggacaaagaactgaagatatatcca
ggttgtcttcataatcccatactcgaactagaagaagataggaagcaagttttggaagac
attaaacaatggctagaaaaaaggatatga

DBGET integrated database retrieval system