KEGG   Crassostrea gigas (Pacific oyster): 105342835Help
Entry
105342835         CDS       T03920                                 

Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:crg03000]
    105342835
Transcription factors [BR:crg03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    105342835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf DUF4988
Motif
Other DBs
NCBI-GeneID: 105342835
NCBI-ProteinID: XP_011448192
UniProt: K1RDJ6
Position
Unknown
AA seq 285 aa AA seqDB search
MTEVSSSQAGDLETSSGISVVHMPSLSQPIQVQSVIHSNTPSVIQTAGPNVQTIQVVRVA
PVDEDLSDDSENKKRREMLSRRPSYRKILNELSSPVAVSKIEEESNSSQSQDGDSPEGTS
NLSGVQYQQGSFLPAGTIQISNSDGVAVSQGLQTLTMTNASPSTTSATGATIVQYAQGPD
GQFFIPDMSGTVQAYQIATSGALPQGVVMATTGSAMSSPQNLSEEASRKRELRLLKNREA
ARECRRKKKDYVKCLENRVAVLENQNKTLIEELKALKELYCQKEG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtaagttcctcacaagcaggagatttagagacaagctcgggaatatctgtt
gtacacatgccctcgctcagtcagcccatacaagttcagtctgtcattcattccaacaca
ccatctgtcattcagacggcgggaccaaacgttcagaccattcaggtggtcagggtagca
ccagtggacgaggatttgtcagatgattctgaaaataaaaagcgacgagaaatgctctca
agaagaccttcatacagaaaaattttgaatgagctatcttcaccggttgcggtgtcaaaa
atagaggaagagtccaacagtagccagagtcaggatggagactcccccgaggggacctct
aacttgtccggggtgcagtaccagcaaggtagttttttacctgcgggcaccatacagatt
tctaactctgatggagtggcagtgtcccagggccttcagacactgaccatgaccaacgcc
agtccatccaccacctccgccaccggcgccaccatcgttcagtacgcacagggacctgac
ggacagttcttcatccctgacatgtcaggaacagtacaagcataccaaatagcaacgtcg
ggggcattaccacagggggtagtcatggcaaccacaggaagtgccatgtccagtccgcag
aatctgtctgaggaagcgtcacgaaagagagagctacgactactgaagaacagagaggcg
gctagagagtgtaggagaaaaaagaaggactacgtcaagtgtttggaaaaccgtgtggct
gtgttagaaaatcaaaacaagacactgatcgaggaactgaaggccctgaaagaactctat
tgtcaaaaggaagggtag

DBGET integrated database retrieval system