KEGG   Crassostrea gigas (Pacific oyster): 105343048Help
Entry
105343048         CDS       T03920                                 

Definition
(RefSeq) protein henna isoform X1
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00360  Phenylalanine metabolism
crg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
crg00790  Folate biosynthesis
crg01100  Metabolic pathways
crg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    105343048
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    105343048
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105343048
Enzymes [BR:crg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     105343048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT ACT_4 DUF3112
Motif
Other DBs
NCBI-GeneID: 105343048
NCBI-ProteinID: XP_011448505
Position
Unknown
AA seq 470 aa AA seqDB search
MDNGISPAKKQKVANGSNNDADKIKSGYLKTQKDPENSVSLLFSLPEKVGALAQVLKIFE
SHQVNLHHIESRPSKQSSTEFEFFVSCDNKTGGLQEALDALKKIAKSFRLLSRKTGESPA
DGTVKTDEDPPKQVPWFPKKICELDRFANQILSYGNELESDHPGFTDAVYRARRKELADI
AFFYKHGQEIPRVKYTEDEISTWRTIYNELTKLYPTHACKQFNHVFPLLQDNCGYNPDNI
PQLEDVSRFLQDCTGFRIRPVAGLLSSRDFLSGLAFRTFHSTQYIRHSSRPMYTPEPDVC
HELLGHVPLFADPAFAQFSQEIGLASLGAPDEYIKKLATCYWFTVEFGMCKQENDLKAYG
AGLLSSFGELQYCLTDASEKKTFDPAVTCDQEYPITSFQPIYFVADSFEKAKEKMREYAK
TIPRPFSVRYNPYTQSVEVIENKNQIINLTHAIKGDLTLLEDALSKIGGI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggataacggaatttcaccagccaagaaacaaaaagtggcaaatggcagcaacaacgat
gccgacaaaattaagagcggctaccttaaaacccagaaagatccggagaatagcgtcagt
ctcctcttctccctccccgagaaagtcggagcgctggcccaggtgcttaaaatctttgag
agccatcaagtgaatttgcaccacattgaatccagaccatcaaagcagagcagtaccgag
tttgaattcttcgtgagctgtgacaacaagactggcggcctacaggaagcactggacgct
ctcaagaagatcgccaagagtttccggcttctgtcgaggaagaccggggaatcccccgcc
gatggtaccgtgaaaactgatgaagatccgccaaaacaagtcccctggtttccaaagaag
atttgtgagcttgaccggtttgccaatcaaattctcagctatggaaatgaactggaatcc
gatcacccgggttttacggatgctgtgtacagggcaagacgaaaggaactagcggatatt
gcattcttttacaagcatgggcaagagatccccagggttaaatacacggaggacgaaatc
agcacatggagaacaatctacaatgaactgaccaaactgtatccgactcacgcctgtaaa
caattcaaccacgtgtttccacttctgcaagacaactgtggttacaatccagacaacatc
ccacaactggaggatgtctccaggtttctgcaggattgtactggattcagaattaggcct
gtggccgggttgttgtcgtcacgtgactttttatcaggattggctttccgcacgtttcat
tcaacacagtacatacgtcacagttcgaggccaatgtacacacccgaacccgatgtttgt
cacgagttattgggtcacgtgcctctctttgctgaccctgcgtttgctcagttttcacag
gaaattgggttggctagtcttggggcaccggatgaatacatcaaaaaattagctacgtgt
tactggttcaccgttgaatttgggatgtgcaaacaagaaaatgatctcaaagcatacggg
gctgggttgttgtcttcatttggtgaattgcagtattgccttactgacgcctcagagaaa
aagacctttgaccctgcagtaacatgtgaccaagaatatccaatcacatccttccagcct
atttatttcgtggcggatagttttgaaaaagcaaaagagaaaatgagagagtatgcaaaa
accattcctcgtccgttcagcgtgcggtacaacccttacacacagagtgtggaggtgatt
gagaacaagaaccaaatcatcaacctcacacacgccatcaaaggtgacctgactctattg
gaagatgccctgtccaaaatcggaggaatttaa

DBGET integrated database retrieval system