KEGG   Crassostrea gigas (Pacific oyster): 105344167Help
Entry
105344167         CDS       T03920                                 

Definition
(RefSeq) twitchin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:crg01001]
    105344167
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:crg04131]
    105344167
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:crg04812]
    105344167
   04147 Exosome [BR:crg04147]
    105344167
Enzymes [BR:crg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105344167
Protein kinases [BR:crg01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   105344167
Membrane trafficking [BR:crg04131]
 Others
  Actin-binding proteins
   Others
    105344167
Cytoskeleton proteins [BR:crg04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     105344167
Exosome [BR:crg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105344167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 ig Ig_2 Pur_ac_phosph_N Tissue_fac V-set Receptor_2B4 Ig_4 SusE Ig_6 F5_F8_type_C
Motif
Other DBs
NCBI-GeneID: 105344167
NCBI-ProteinID: XP_011450130
Position
Unknown
AA seq 3328 aa AA seqDB search
MVTLTCELSKPDIPCKWFKNDTEIQPSNHAQISYDGYTQQLVLTDVTVDDTAKYSCVCGD
VSTEATLQVQESLKFIRELSEMRVIEEQTVTLECEVNQPGLTATWLKDKQPVVLKKSDFI
RVKEGVHSLVIATVEIDDEAEYTVQIGELSSSAPLFVEEAPVEFIKPLKDIQVMEKTKVV
LECEVSKPNLIATWYVDGEEIKSSDRVELVVYDTVHQLIIETAKLTDEGKYTIDVEGQKS
SATLLVDESPVELVARLHDIIVPAKGSAVFECEVSLPGVKPQWYKDEEPITVSDGYDIRS
DGTHHYLYLDKVGPDDIGDYTIQFDDVECTASLQIEEPPLKITKPLEKKEVPEKEPLTLS
CEVSKPGVMGKWFKDNKEILSSEHIKVIDDENVHKLEILDASLADSGTYKCKLEDKETIC
KVTVKEKPLEFVKPLKDIEVTEGQDIVLECVVSKEGMKASWQKNGKALPVDNRIKVTADK
DTYRLTITSAMVEDKAEYKVKVADKSSTAKVFVEEEVVEFVRKLSDVEVKEIPSTVTFEC
ELSKPDMVAKWFRDGKPLGESDKYQMVVDGTVHKLVITDVDGEDEGDYSIVARGKKSEGE
LIVEVPPQLFLDKQFEEEVVLKAGQSTAFEIPFKGNPQPKATWTYNNEPLPQEKRIESET
IYNMTTLRLGKVKRSDTGNYTLTLDNSAGKVSITIKLTVLDKPTAPQDLTPSEVTADSIT
LTWQTPADNGGSEILEYIIEKKEFNRRTWQQMGTTKDLTFTIPKLLEGNQYFFKVAARND
IGIGDAAETKEAITAKNPFVVPDAPEAPVVSDITATSATVTWQPPANDGGSPITGYRLER
ISGFSGRWVPISKELIPETTFSVIDLVEGNTYEFRVIAENKAGPSKPSPPSQNIKAVNPW
TKPNAPGTPEIIKTDKTSADLKWTPPTEDGGAPITNYVIEYRPSGSVRWNRANSSPVTET
TFSVADLKEGSEYEFRVSAENKAGVGPASEPSKSVKVVKPLVGTAPKVLENLCEATIVSP
EPVTLKCVLDFGEPVAEVKWFKGPKEIKKSQKFTINIEDKVASLVIQETEPQDAGVYRCM
AINPLGQCQTEATLAIHTHPKLEYENKLKAKQLVKVGQSISLQVNISGIPNPTVQWAQNG
SVIEKSPKISIETTDVFSMLTVKNASLEDTGVYSITAENVVGKAQAEFDVAIRDKPGKPN
NLQVIQVMKESVVLSWQPPTNTGGSEIIGYTIEKRDAKRNTWAQVANVDSETTTYAVQKL
IEGNEYFFRVSAKNDMGTGEPAEIDRGTVAKCPYDVPGAPRNLQPTEVNKSSVTLTWEVP
DQDGGSPVTGYIVERRQTTATRWTKAHKQTLTETLFTATDLIEMSEYEFRVAAENAAGIG
KPCEPIGPILTKSPYDVPDAPAKPQITDVTKDTATLTWTPPEKDGGSPVFNYVIEYKPVR
ASKWISASHNITVANTTFTVKDLTEGMEYEFRVLAENKAGLSKPSAPSSVIVREPVSGEA
PSVLEGLPDISVLLGEDATMECQISGKPEPSVTWSKDSHRIDASKKYEMSQDEISVSLTI
RDVSEKDSGSYTLEASNDLGSVSTSGQLDVQAKPELEFDNKFRDVITLNTGTSLRIPVNY
KGLPKPTITWGKDEKPLKAGGSVTLDTKDTLTTLQVKKVTRADDGLYFITAENEAGKAKA
TFDVEVIDVPDQPEGPIKISDINRDRVTLSWAPPKDDGGSKIKSYTVERREQGRSMWSKV
DTVDASKTSIVATGLSQGKEYFFRIYAENDIGLSKPLESKQAVIPKSPFEKPSSPTGPLS
TKDITEDSVTLSWQPPASDGGTAVTGYLLEKYDNRRRSWVKVADLDVKTTSFVVPKLIEG
EKYKFRVSAVSAEGQGQPLETEEDVVPRKPASAPEKPSGPIKFSNILGDSVTLTWSPPKK
DGGAPIQSYKVELSEDNGKTWKQVENIDSTKYTVTGLKSGDKYKFRVAAVNELGDGEALL
SEAVVPQRPTDAPAQPFGPLEPKNIRKDSLTLTWQAPKDDGGSPITGYIVEKRENRKGKW
TPVEKVSKNITELDVKRLEEGKEYYFRVRAENKKGVSEPLETEKSIVPKSPFDKPSAPEG
PLSVSNLTATSADLEWKPPTKDGGSPITGYVIESKPSTRGNWTKVANVDGSTTKYSPKDL
REGTEYLFRVSAINEEGTGSPLETKELVKPQKKIDAPSSPRQFKISKLGPDFVTLDWKSP
SSDGGSKVTGYMVKQKRGPDGDWEEVATLKAFDTSYKVPKLKEDQEYFFSITALNQKGPG
EICELDTPVVPKRPPGPPSKPIGPIEVSDINKTSAKLSWKPPTHDGGSPLTGYLVEKREG
RRPWTKVDKISPELTEFQVTGLTEGADYSFRITPINKLGNGESLETEATIKPKSLFDKPE
KPTGPITFSDITNESVTLNWQPPAKDGGAPVTNYVIEYRDAKRTTWSKAGDVSADKTFFV
ADKLLTGNEYYFRVIAVNEEGQGQPLESLETVRPEKPIAPPKAPSNLAVKKVESNSATLN
WKPPQEDGGSKVTAYKVKVREEGSDKWKDLATLTPYDTEYTAKNLKTGKEYHFAIVAENK
AGLGDAAETESSIIPRKKPEKPSPPVGPIKFSDIQKTSLVLAWKPSKNDGGSPLTTYYVE
MRDSKYGSWTSVTKVTPDITSYCVQKLKTEKEYFFRVIAENSVGKSEPLTSDGVIPKSPY
TAPSAPQGPMQFSDLTDKSVTISWRAPASDGGLPLKEYVLERRDTKRTSWAPVDKVSPDI
TSYTVQNLVVGNDYYFRVMAVNEEGTSPPLEGEPVRPQKGVEAPSVPRGPLNISDVTGSS
AALTWKLADQDGGSPITEYLIEASTDNENWNKLGTVDKLSNKYKAQNLEDGKDYTFRVSA
VNKVGPSQPLVSKPVSIKKPAEAPSKPLGPITTSDINKDSVTLSWQPPESDGGSPLTEYV
IEKRDTKRNTWAPATKVPANKTSCVVDKLQEGSDYMFRVSTVNKKGSSKPLESESPVTAK
SPFGKPSTPVGPLSVSDVTEKTASVSWKPPESDGGLPLTGYLLEVRDSRRTAWKKVADLK
PAQTSYTVPDLDIDNEYFFRVTALNKEGAGSPLQTQEATKITKDISPPGPPVSIKVPKVG
EDFVELDWKAPSRDGGSKVKAYHIYQCTTPGDWQEVATVKSFDNHFSVSGLKEGVAYNFA
IAAENEAGVGKMCEADKPVKTVKPKGKPSMPEKPFVAKDIQKTELTLTWKPSQSDGGSPT
TGYRVEKRESWKSSWVEVDTTRPGVCELTVKRLKEGQEYFFRVCAENKIGQSEFLELETS
VTPKSPFCKYIVLTNVKICHHCILCHCQ
NT seq 9987 nt NT seq  +upstreamnt  +downstreamnt
atggttaccttaacttgtgaactctccaaaccagacattccctgtaaatggttcaagaat
gacactgaaatccaaccaagcaaccatgcacaaatttcttatgatggttacacccaacaa
cttgtactaactgatgtcactgttgatgatactgccaaatactcttgtgtgtgtggtgat
gtttctactgaagccacactgcaagtgcaggaatccctgaaattcatcagagaactatca
gaaatgcgtgtcattgaagaacagactgtgaccttggaatgtgaggtcaaccagccaggt
ctgactgccacttggttgaaggacaaacaacctgtggtcctcaaaaagtcagacttcata
cgtgtcaaggaaggcgtgcacagtctggtgatcgccactgtggagattgatgatgaagca
gaatatactgtacagataggagagctctccagctctgctcctctctttgtggaagaggct
ccagtggaattcatcaaaccactcaaggacattcaggtaatggagaagaccaaggtcgta
ttggagtgtgaggtcagcaagcctaatctgattgccacctggtatgtggatggggaggag
atcaagtcttctgaccgtgtcgagcttgtcgtgtatgacacggtccaccagctcatcatt
gagacagccaaactcaccgatgagggcaaatacaccattgatgtggagggacagaagtcc
tctgccacacttctagtagatgagtccccagttgaattggttgcacgcttgcatgacatt
attgtcccagccaagggttcggcagtgtttgagtgtgaagtttccttgcctggtgtcaaa
cctcagtggtacaaggatgaagaaccaatcacagtcagcgatggttatgacattagatct
gacgggacccaccactatttgtacctagacaaagtgggacctgatgacattggagactac
accatccagtttgatgatgttgagtgcactgcatctcttcaaatcgaagaacctcccctt
aaaatcaccaaaccactcgaaaagaaagaggttcctgaaaaggaacccctgacattgagc
tgtgaggtatctaaaccaggagtcatgggtaaatggttcaaagacaacaaggaaatcttg
tcatcagaacacatcaaagtcattgatgatgaaaatgttcacaaactggaaattctagat
gccagcctagctgatagtggaacctacaaatgtaaactggaggacaaagaaaccatctgc
aaggtcactgtgaaagaaaaacctcttgaattcgtcaaacccctgaaggacattgaggtc
actgaaggtcaagacattgtccttgagtgtgtagtgtccaaggaaggtatgaaggccagc
tggcagaagaatggtaaagcattgcctgtagacaacagaatcaaggtcactgctgacaag
gacacatacagactgaccatcacctcagcaatggtggaggacaaggctgaatacaaagtc
aaggtcgctgacaagtcatcaacagccaaggtctttgtagaagaagaagtagtggagttt
gttcgcaaactttcggatgttgaagtgaaggaaattccctctaccgtgaccttcgaatgt
gaactctccaaaccagacatggtagccaagtggttcagagatggaaaacccttgggagaa
agtgacaaataccagatggttgtggatggaacagtccacaaactggtcatcacagatgtg
gatggagaggatgaaggtgactacagcattgttgccagggggaagaaatctgagggagaa
ctcattgtagaagtgcctccacaactatttttggacaaacaattcgaagaggaggtggtt
cttaaggctggccaatccacagcctttgagattccattcaagggtaatccacaacctaaa
gcaacctggacctataacaatgaaccactgccacaggagaagagaatagagagtgagacc
atatacaacatgaccacactgagactgggcaaggtcaagaggtcagacacaggaaactac
actctgaccctggataactcagctggcaaagtctccatcaccatcaaactgactgtgctg
gacaaacccactgccccacaggacctgacaccttcagaggtgacagcagactctatcaca
ctgacatggcagactccagctgacaatggcggcagtgaaatattggagtatatcatcgaa
aagaaggagttcaaccgccggacctggcaacagatgggaactaccaaagatctgaccttc
accattccaaaacttctggagggcaaccagtatttcttcaaagtcgctgccagaaatgac
attggcattggagatgctgctgaaacaaaagaggccattacagccaaaaatccctttgtt
gtaccagatgcccctgaagctccagttgtgtctgacatcactgctacctcagcaactgtt
acctggcaaccaccagccaatgatggaggatctccaattactggataccgcttggagagg
atttcaggcttcagtggtcgatgggttcctatttccaaggagctcatcccagagacaaca
ttcagtgtcattgacctggtggaaggcaatacctatgagttcagagttattgctgaaaac
aaagctggcccaagcaagcctagcccaccatcacaaaacatcaaggcagttaatccatgg
acaaaaccaaatgcaccaggcactccagagatcatcaaaacagacaagacatctgctgac
ctcaaatggacaccaccaacagaggatggcggagcacccatcacaaactacgtcattgaa
taccgtcccagtggttctgtccgctggaaccgtgctaacagctctcctgtcacagaaacc
acatttagtgtggcagaccttaaggagggatctgagtatgaattcagggtatctgccgaa
aacaaggctggtgttggcccggcttctgaaccttccaaatctgtcaaggttgtaaaacca
ttagttggaactgctccaaaggttctagagaacctgtgtgaagccaccattgtatcgcct
gaaccagtcaccctgaagtgtgtccttgactttggagagccagtggctgaagtcaaatgg
ttcaaaggaccaaaggaaatcaagaaaagccagaagtttaccataaatatagaggacaag
gttgcttcccttgtcatccaagagacagaacctcaggatgctggtgtgtaccgctgtatg
gccatcaaccctctcggtcagtgtcagacggaggccactctagcaatccacactcatcca
aaactcgaatatgaaaataaactgaaggccaaacaactggtaaaggttggacagtccatc
tccctacaagtgaacatcagtggaatccccaaccctacagtacaatgggcacagaatggc
tctgtgattgagaaatcacccaagatcagcatcgagaccacagacgtgttcagtatgctg
actgtgaagaacgccagcctagaggacaccggggtgtactccatcaccgcggagaatgtg
gtgggcaaggcccaggccgagtttgatgtagccatcagagacaaacctggcaaacccaac
aacctccaggtaattcaagtcatgaaggaatctgtcgtattgtcatggcaaccacccacc
aacacaggtggttctgaaatcattggttacaccattgaaaagagggacgccaagcgtaac
acatgggcccaagtggcaaatgtagacagtgaaaccaccacttacgctgtacagaaactt
attgagggcaacgaatacttcttcagggtgtcagctaagaatgacatgggcactggagaa
ccggctgaaattgaccgaggaacagttgcaaaatgcccttatgacgtaccaggagctccc
agaaatctgcagcccactgaggtcaacaagtccagtgtcactctgacctgggaggtccca
gatcaagacggtggttccccagtcacaggctacatcgtggagcgccgccaaaccaccgcc
actaggtggaccaaggcccacaaacaaacactgacagagactctgttcacagctactgat
ctgatagaaatgtcagagtatgagtttagagttgctgccgaaaacgcagcaggaatcgga
aaaccatgtgaaccaataggacctattctgacaaagagcccatatgatgtgccagatgcc
ccagccaaacctcagataacagatgttaccaaagacacagcaacactgacttggacacca
ccagaaaaagatggtggtagccctgttttcaactatgtcattgaatacaaaccagtgaga
gcctccaagtggatctcagccagtcacaacattacagtggccaacacgacattcactgtc
aaagacctgacggagggaatggagtatgagttcagggtcctggcagagaacaaagcagga
ctcagcaagccatctgctccttcctctgtcattgtcagagagcctgtcagtggggaagca
ccttctgtactggagggactccctgacatcagcgtactcctgggtgaagatgccactatg
gaatgtcaaatcagtgggaaaccagaaccatcggttacttggagcaaggacagtcacaga
attgatgcaagcaagaagtatgagatgagccaggatgagatatctgtctcactgactatc
cgagatgtctcggagaaggactcaggcagctacaccctggaggcatccaatgatctcggc
tctgtgtctacttctggacagcttgatgtacaagccaaaccagagcttgaatttgacaat
aagttccgggatgtaataacactgaacaccggaacatctctaagaataccagtcaactat
aagggtctccccaagcccaccatcacctggggcaaggacgagaaacccctgaaagcaggt
ggtagtgtcacacttgataccaaggacacactcacaaccttacaggtcaagaaggtcaca
agagcagatgatggcctctatttcatcacagctgaaaatgaggctggaaaagccaaagca
acctttgatgttgaagtaattgatgtaccagaccaaccagaaggccccatcaagatcagt
gatattaatcgtgaccgtgtcaccctctcttgggccccacccaaagatgatggtggaagc
aaaatcaaatcctatacagtggagagaagagagcaaggcagatccatgtggagcaaggtg
gatactgtggatgcatctaagacctccattgtggctacaggactctcccaaggaaaagaa
tactttttccgtatctatgctgagaatgacattggtttatccaagcctctggagtccaaa
caagcagtgattcccaagagtccgttcgaaaaaccatcaagtcctactggtcctttgtct
accaaggacatcacagaagattcagtgacattgtcatggcaaccacccgcatctgatggt
ggtactgctgtcacagggtatctgctggagaaatatgacaatcgccgaaggtcatgggtc
aaggttgctgaccttgatgtcaagactacatcttttgttgtgccaaaacttattgaagga
gagaagtacaagttcagagtctctgctgttagtgccgagggtcaaggacaaccgctggag
acagaggaggatgtggttccaaggaaaccagcatctgcaccagaaaaacccagtggacca
atcaaattctccaacattttgggtgactcagtgactttgacatggtccccacccaagaag
gatggaggtgccccaattcagtcctacaaggtagagctgtctgaagacaatggaaagaca
tggaagcaagtggagaacatcgactccaccaaatacaccgtcacaggcctgaagagtgga
gacaaatacaagttcagggtggcagcagtcaatgagctgggagatggagaggcacttctg
tctgaggcagtggtaccccagagaccaacagatgctccagctcaaccatttggacctctg
gaacccaagaacatcagaaaggattctctcacactgacctggcaagctcccaaagatgat
ggaggcagtccaatcactggttacattgttgaaaagagagagaacaggaaaggaaaatgg
acacctgtagaaaaagttagcaaaaatatcacagagctcgacgtcaagcgcctggaagag
ggcaaagaatattacttcagagttcgtgctgagaacaagaagggagtcagtgaacctctg
gagacagagaaatccattgtacccaagagtccatttgacaagccatctgccccagaggga
ccactcagtgtgtccaatctgactgctacatcagctgacttggaatggaaaccaccaacc
aaagatgggggttctccaatcaccggctatgtaatcgagtccaaacctagcactagagga
aactggacaaaagtggccaatgtggatggtagcaccaccaaatactcacctaaagacctc
agagagggaacagaatatttgttcagggtgtctgctataaatgaagagggaacaggttcc
ccactggagactaaagaacttgtcaaaccacaaaagaagattgatgccccatcttcacca
agacaattcaaaatatctaaacttggacctgattttgtcacacttgattggaaatcccca
tcctcagatggaggctccaaggtcactgggtacatggtgaagcaaaagagaggccctgat
ggagactgggaggaggtggccactctgaaggccttcgatacatcgtataaggtccccaaa
ctcaaggaagaccaggagtacttcttctctataaccgcactaaaccagaaaggaccagga
gaaatttgtgaactggacacacctgttgttccaaagagacctccaggtcctccatcaaaa
ccaattggcccaatagaagtcagcgacattaacaagacgtctgccaagctgtcctggaag
cccccgactcatgatggaggttcccccctcactggatacctggtggagaaacgcgaggga
cgtagaccatggactaaggtagacaagatctcgcctgaactgacagagttccaggtgaca
ggactgacagaaggggctgattactccttcagaatcacacctatcaacaaactgggaaat
ggagagtctctcgagactgaagctaccatcaaacctaagagtctctttgataaaccggaa
aaaccaactggaccaatcacattctcggacataacaaatgaatcagtgactttgaactgg
caacctccagctaaggacggtggagccccagtaacaaactatgtcattgagtacagggac
gccaagaggaccacctggtccaaggcaggggatgtgtcagctgacaaaacattctttgta
gctgacaaactcttgactggaaatgaatattactttagggtcattgctgttaatgaggaa
ggtcaaggtcaacctcttgaatccttggaaacagtcagacccgaaaagcctattgcacca
ccaaaggcaccaagcaatctagcagtgaagaaagttgagagcaacagtgcaactctgaac
tggaaaccacctcaagaagatggaggttcaaaggttacagcttacaaagtcaaagtgaga
gaggaaggctcagataaatggaaagaccttgctactctcactccctatgatacagagtat
acagctaagaacctcaaaacaggaaaagagtaccactttgccattgttgcggagaacaaa
gctggtcttggtgatgctgctgagactgaatcctccatcatcccaaggaagaagccagaa
aaaccatcaccaccagttggtccaatcaagttctcagacatccagaaaacttctttggtg
ttagcttggaaaccaagcaagaatgatggtggatctcctctgactacttactatgttgag
atgagagactctaagtatggatcctggacctccgtcaccaaggtgaccccagacatcacc
agctactgtgtacagaaactcaagacagaaaaggagtatttcttcagagtcattgcagag
aacagtgtgggaaaatcagaacctctgacctcagatggagtcattccaaagagcccatac
actgcaccatctgcccctcagggtccaatgcagttctctgatctgactgacaagtccgtg
acaatcagctggagagctcctgcctcagatggaggactccctctgaaggaatatgtccta
gaaaggagagacacaaagcgcaccagctgggccccagtggacaaagtcagcccagatatc
accagctacactgttcagaacttggtggttggaaatgactactacttcagagtaatggct
gtaaatgaagagggaaccagtccaccgttggagggagaaccagtcagaccccagaaggga
gtcgaagcacccagtgtacctagaggtccacttaacatcagtgatgtgactggatcctct
gccgctctgacctggaaacttgcagatcaagatggaggttcacctatcactgaatacctt
attgaagcctctacagacaatgaaaactggaacaaacttggaaccgtggacaaactctca
aataagtacaaagcacaaaatctagaagatggcaaagactataccttcagggtttctgct
gtcaacaaagtaggaccaagccagcctttggtgtctaaaccagtgtccatcaagaagcca
gcagaagctccaagcaagcccctaggaccaataacaacctcagatatcaacaaggattct
gtcactctgtcctggcagccaccagaaagtgatggaggatctccactcactgagtatgtc
attgagaaacgcgacaccaagagaaacacatgggccccagctaccaaagtacctgctaac
aagacatcttgtgtagtggacaaacttcaggagggatctgattacatgttcagagtgagc
acagtcaacaagaagggatccagtaaacccctggaatcagagtctcctgttacagcaaag
agtccatttggtaaaccatccactcctgttggacctctatctgtttctgatgtcacagag
aagacagctagtgtttcttggaagccgcctgagagtgatggtggcctgcccctgaccggg
tacctcctggaggtccgtgatagccgccgcactgcctggaagaaagtggcagacctgaaa
ccagcacagacatcatacactgtcccagatctagacattgacaatgagtacttcttcaga
gtcactgctctcaacaaagagggcgcaggctctcccctacagactcaggaggcaacaaaa
atcacaaaggatatatcaccaccgggtccacctgtatccatcaaggtaccaaaggttgga
gaggactttgtggaactcgactggaaggccccatccagagatggtggctctaaggtcaag
gcatatcacatctaccaatgcaccaccccaggggactggcaggaggtggccactgtcaag
agctttgacaaccacttctctgtctcaggcctcaaagagggtgtagcatacaactttgct
attgctgcagaaaatgaggcaggagttggaaaaatgtgtgaggcagacaaaccagtcaaa
actgtcaaaccaaaaggaaaaccatctatgccagaaaaaccatttgtagccaaggatatc
caaaagacagagttaaccttgacctggaaacccagccaatcagatggaggctctccaacc
acaggttacagagtggagaaaagggagagctggaaatcctcctgggtggaggtggacacg
actcgtccaggggtctgtgaactcacggtcaaacgtctgaaggaaggtcaggagtacttc
ttcagagtttgtgctgagaacaagatagggcagtctgagttcctggagttggagacctca
gtcacaccaaagagtcctttctgtaagtacattgtgctcactaatgttaaaatctgtcat
cactgtatattgtgtcattgtcagtga

DBGET integrated database retrieval system