KEGG   Crassostrea gigas (Pacific oyster): 105344687Help
Entry
105344687         CDS       T03920                                 

Definition
(RefSeq) palmitoyltransferase ZDHHC5-like isoform X1
  KO
K20030  palmitoyltransferase ZDHHC5/8 [EC:2.3.1.225]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:crg04131]
    105344687
Enzymes [BR:crg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     105344687
Membrane trafficking [BR:crg04131]
 Protein recycling
  Others
   GRIP associated proteins
    105344687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF4059
Motif
Other DBs
NCBI-GeneID: 105344687
NCBI-ProteinID: XP_011450821
Position
Unknown
AA seq 574 aa AA seqDB search
MSSRLIPAICAWGLTLGTTSLFFVFVCPALIDFSLLYTLAIPIYEGILTLFVLLNFGLAT
FMDPGYYPRAHEDEVKDDDFRAPLYKPVEINGIAVRMKWCTTCQFYRPPRCSHCSVCNKC
IETFDHHCPWVNNCIGRRNYRFFFLFLCSLCIHMISVFSFCLVYVLRHKEDLKTVGNIVA
LIDMIIIGLLVFPVSGLTGFHIVLVSRGRTTNEQVTGRFKGGHNPFTKGCCLNCKYALCG
PVWPKLSSYVPKHRTLSLDALKVKYSSANKEIKLYSDASTNGVKRNTAVVNQNAPRTPLL
SDHQDDLHSQGSSQSAGSEIHDYRKSDSYTNLFDTSQSKPVSSSSSNYQPSRGPPIVHQP
RIEQSPQRGRRARQQDSKAPMALPEESIMGSPSKYTPPARNILNSPGIDRSNNYQSRQET
RPSQPQYSSRDSPGYNKPQYFGQQNGHRRERTPSAEGSVDSVDRRPLMNTSVSSGYNSRS
FDTSPLGRSQTLPNNQGGFYEEDPRTAKRPMSFVKALEMSHLVEQNQQGARNVAVQGKKP
PVPQQGSHHPHKQKGRHREGKKKVVYDTNFEVSV
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcagattaattcctgcaatctgtgcgtggggtttgaccctaggaacgacgtca
cttttctttgtttttgtgtgccctgccttgatcgacttttctttgctgtatacgctagcg
attccaatatatgagggcattcttactctatttgtcttgctcaactttgggcttgcaact
tttatggacccaggatattatcccagagcacatgaagatgaggtaaaagatgatgatttt
cgagcgccattgtacaagccagtagaaataaatggaattgcagtcagaatgaagtggtgt
accacttgccaattttatcggccacccagatgctcccattgtagtgtttgtaataaatgt
attgagacatttgaccatcactgcccatgggtgaataactgtataggccggaggaactac
agatttttcttccttttcttgtgttcattgtgcatccatatgatcagtgttttctccttt
tgcttggtgtatgtcctaaggcacaaagaagatctaaaaactgttggaaatattgtagca
ttaatagacatgataattattgggttactagtattccctgtgtcagggcttactggcttt
cacatcgtgttggtgtcaagggggagaacaaccaatgaacaggtcactggcaggttcaaa
ggaggacacaatcccttcaccaaaggatgctgcttgaactgtaaatatgccctgtgtggt
cctgtctggcccaaattatcctcttatgtgcctaaacatagaacactatcattagatgca
ttgaaagtcaagtactcatctgctaacaaagaaatcaagctgtattctgatgcaagcacc
aatggagtgaaaagaaatactgcagttgtgaaccaaaatgccccccgcactccacttttg
tcggatcaccaagacgacctacatagccagggaagtagccaatcggcaggctcagaaatc
catgattatcggaagtctgattcttatacaaatctttttgacacttcacagtcaaagcct
gtttcatcgtcgtccagtaattaccaaccatctcgaggtccccctattgttcatcagcct
cgaattgaacagtcacctcaaagaggcagacgagcaaggcaacaggattcaaaggcaccc
atggctcttccagaggaatccatcatgggatctccatcaaaatatactcctcctgcccgt
aatattctgaacagcccaggtatagatagaagtaacaattaccagtctcgtcaagagacc
agaccttcacaacctcagtacagttctcgcgactctccggggtacaataaaccacagtac
tttggtcagcaaaatggacacagaagggagagaactcccagtgccgaggggtctgtggac
agtgtcgataggagacccttaatgaacacctctgtgtcatctggatacaactccagatcg
ttcgacacctccccactggggagaagtcagacattaccaaacaatcagggaggattctat
gaggaagatccaaggactgctaagagacctatgtcttttgttaaggctctagaaatgagt
catttagtggaacaaaatcagcagggggcaaggaatgtggctgtacaaggcaagaagccc
ccagtcccacaacaggggtcccaccacccccacaaacagaagggcaggcaccgggagggc
aagaagaaggtggtttatgacacgaactttgaagtttctgtttga

DBGET integrated database retrieval system