KEGG   Crassostrea gigas (Pacific oyster): 105346020Help
Entry
105346020         CDS       T03920                                 

Definition
(RefSeq) NEDD8-conjugating enzyme UBE2F
  KO
K10687  ubiquitin-conjugating enzyme E2 F [EC:2.3.2.23]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:crg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105346020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:crg04121]
    105346020
Enzymes [BR:crg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     105346020
Ubiquitin system [BR:crg04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   105346020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B DUF4985
Motif
Other DBs
NCBI-GeneID: 105346020
NCBI-ProteinID: XP_011452771
Position
Unknown
AA seq 153 aa AA seqDB search
MITLSKKLKQPPESPKNKKVAEDITKRISIRDKLLVKEVQEMEENLPKTCTVNFEDPNKL
HVFDLTIVPDEGFWKSGKFKFRLDIPEEYNIVPPNVVCNTRIWHPNINEDGEVCLSLLRQ
NSYDSLGKTGLMQFYKVRLKVTSMRTEDILEWE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgataactctctcaaagaagctgaagcagcccccagagtcgccaaaaaacaaaaaagtt
gctgaagacattacaaagagaatatccattcgagataaacttttagtcaaagaggttcag
gagatggaagaaaacttacctaaaacctgcactgtgaactttgaagatcctaataaatta
catgtgtttgatctgactattgtcccagatgaaggattttggaagagtggaaaatttaaa
tttcgtcttgatataccagaggaatataacatagtacctccaaatgttgtgtgtaataca
aggatatggcaccctaatattaatgaagatggagaagtttgcctaagtctgctacgccag
aactcatacgacagcttaggtaagacgggtttaatgcaattttacaaagtaagattaaag
gtaacctcgatgagaacagaggatatattggaatgggaatga

DBGET integrated database retrieval system