KEGG   Crassostrea gigas (Pacific oyster): 105347679Help
Entry
105347679         CDS       T03920                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:crg01002]
    105347679
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:crg04147]
    105347679
Enzymes [BR:crg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105347679
Peptidases [BR:crg01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   105347679
Exosome [BR:crg04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105347679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2 Thioesterase Peptidase_S9 VirJ DLH Lipase_3 LIDHydrolase Say1_Mug180 Cutinase Ser_hydrolase DUF818 PAF-AH_p_II COesterase
Motif
Other DBs
NCBI-GeneID: 105347679
NCBI-ProteinID: XP_011455148
Position
Unknown
AA seq 302 aa AA seqDB search
MKIYPRIQEKLIFLNFVCWPPFMDVTKPDELGLTGVRNFYLDVDEEITIGAWHLLPKSLI
RNETLDFESKLSSGHPIFLYLHGSTGTRGGWHRVQLMKLLTSLDFHVVTIDYRGYADSTG
HPSEDGVVDDSHFMYRWIKERSGASQVVLWGHSLGAAITTKLAKRLCEEGVDPHGVILES
PFNNIRDAALSHPFAAPFQHIPFYKKLILDSVAQNNVFFTSDENIAAVKSPVIIMHAEDD
LVIPYDLGLKLYKSAQQNRPEGSGPLQFVPLKASFGYGHKHIFQAPELPEIIKNFLGTCK
RK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttatccccgaattcaggaaaaactcatcttccttaattttgtgtgttggcca
ccatttatggatgttactaaaccagatgaactaggactaactggagttaggaatttttac
cttgatgtagatgaagagattacaataggagcatggcatcttcttccaaaatctttaatt
agaaatgaaacactggattttgaatcaaaattaagcagtggtcatcccatctttttatac
ctgcatggatctacaggaacaagaggcggctggcacagagttcagttaatgaagttactg
acatcactggattttcatgttgtgaccatagattatagaggatatgctgattcaactggt
catccctcggaagatggagtggtggatgatagccatttcatgtaccgatggatcaaagag
agaagtggggcctctcaagtggtgctgtggggacattctttaggagctgcaattacaacc
aagttagctaaacgtttatgtgaagaaggagttgacccacatggagttatattagagtct
cccttcaacaacattagagatgctgccctcagccatccatttgcagcaccatttcagcat
atacctttctacaaaaagctcattttggattctgttgctcaaaacaatgtgttctttaca
agcgatgaaaacattgctgcagtaaaatccccagtgataataatgcacgcagaagatgat
ttagttattccttacgatcttggactaaaattgtataaatctgcccagcagaacaggcct
gagggcagtggtcctctccagtttgtgcccctcaaagcctcctttggatatggacataaa
catatatttcaagctccagaattaccagaaattataaagaattttttagggacatgcaag
aggaaatga

DBGET integrated database retrieval system