KEGG   Crassostrea gigas (Pacific oyster): 105348304Help
Entry
105348304         CDS       T03920                                 

Definition
(RefSeq) heat shock protein 68
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg03040  Spliceosome
crg04141  Protein processing in endoplasmic reticulum
crg04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:crg00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    105348304
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105348304
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105348304
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:crg01009]
    105348304
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:crg03041]
    105348304
   03009 Ribosome biogenesis [BR:crg03009]
    105348304
   03110 Chaperones and folding catalysts [BR:crg03110]
    105348304
   04131 Membrane trafficking [BR:crg04131]
    105348304
   03051 Proteasome [BR:crg03051]
    105348304
   03029 Mitochondrial biogenesis [BR:crg03029]
    105348304
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:crg04147]
    105348304
Protein phosphatases and associated proteins [BR:crg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     105348304
Spliceosome [BR:crg03041]
 Complex B
  Other components
   Prp19 complex
    105348304
 Complex C
   Prp19-CDC5 complex
    105348304
Ribosome biogenesis [BR:crg03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    105348304
Chaperones and folding catalysts [BR:crg03110]
 Heat shock proteins
  HSP70 / DNAK
   105348304
Membrane trafficking [BR:crg04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    105348304
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    105348304
Proteasome [BR:crg03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    105348304
Mitochondrial biogenesis [BR:crg03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    105348304
Exosome [BR:crg04147]
 Exosomal proteins
  Proteins found in most exosomes
   105348304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 105348304
NCBI-ProteinID: XP_011455958
Position
Unknown
AA seq 634 aa AA seqDB search
MASKAPAIGIDLGTTFSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNANNTIFDAKRLIGRKFNDDSVQSDMKHWPFTVINDGGKPKLEVEFKNEKKRFTPEEI
SSMVLTKMKETAEAYLGQTVRDAVVTVPAYFNNAQREATKDAGVIAGLNVLRIVNEPTAA
ALAYGLDKNISGEKNVLIFDLGGGTFDVSILTIDEGSIFEVRSTAGDTHLGGEDFDNRMV
NHFVQEFKRKYNKDISKNNRSLRRLRTACERAKRTLSSSSEANIEIDSLFEGMDFYSKIT
RARFEELCADLFRGTLEPVEKALRDAKMDKSKIHEVVLVGGSTRIPKIQKMLQDFMGGKE
LNKSINPDEAVAYGAAVQAAILKGDKSDAIKDVLLVDVTPLSLGIETAGGVMTKIVERNA
KIPTKASQTFTTYSDNQPGVSIQVFEGERAMTKDNNKLGTFELNGIPPAPRGVPQIDVEF
DIDANGILNVSAKDKSTGKSNKITITNDKGRLSKADIERMVNEAEKYKEEDDKQRQRIAA
RNQLESYVFTVKQAAEDTGDKLQSEDKETISRVCSETVSWLDNNALAEVDEYEFKLKEVQ
KVCSPIMAKLHQNGSTGNPGPASSSQGPTVEEMD
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtaaagctccagccatcggcatcgacctgggaacgacgttttcctgtgtcggt
gtatttcaacatggaaaagtggaaatcatcgccaacgaccaaggaaacagaacgacgccc
agctacgtcgccttcacagacacagaaagactgataggagatgcggctaaaaaccaggta
gccatgaacgccaacaatacaatctttgacgccaagaggctgataggccgcaagttcaac
gacgacagtgtacagtccgacatgaaacattggccgttcacggtgatcaatgatggagga
aaacccaagctagaagtggaattcaagaacgagaaaaagagatttacccccgaagaaatc
agctcaatggtgctgaccaaaatgaaggagacagcagaagcttacttgggacaaactgtc
cgagacgcagtcgtcaccgttcctgcctacttcaacaacgcccagagagaggccactaaa
gacgccggagtgatagccggtctcaatgttctcaggatagtaaatgaacccacagctgcc
gctctggcctatggtctggataagaacatttccggcgagaaaaacgttctcatctttgac
ctcggaggtggtacatttgacgtgtccatccttaccattgatgagggctccatatttgag
gttcgctccactgcaggggatactcacttgggaggtgaagatttcgacaatagaatggtc
aatcactttgtgcaggaattcaagcgcaagtacaacaaagacatttcaaaaaataaccgt
tcactgagacgactcaggacggcttgcgagcgtgccaagagaaccctgtccagcagttct
gaggccaacattgagatcgactcgctgtttgagggaatggacttctacagcaaaatcaca
cgagctagatttgaagaactgtgtgcagatttgttccgtggaaccttagaacccgtcgag
aaagccctgcgggatgccaaaatggacaaatctaaaattcacgaggtggttctggttgga
gggtcgacacgaattccaaagatccagaaaatgctccaagacttcatgggcggaaaagaa
ctgaataaatctatcaacccagatgaggctgtagcctatggtgccgctgtccaagcggct
attctgaagggagataagagtgatgccatcaaggacgttctcctggtcgatgtcactcca
ttgtctctaggcattgaaactgctggaggggtcatgacaaagatcgtcgaacgaaatgcc
aagattcctaccaaggcatcacagaccttcaccacatactccgataaccagcctggtgta
tccattcaggtgtttgaaggtgaacgagccatgacaaaagacaataacaaattaggtact
tttgaactgaatggaattcctcccgcccctcgaggtgtcccacagattgacgtggagttt
gacattgacgccaacggtatcttaaacgtatcagccaaggacaagagcacgggaaagtcc
aacaaaatcaccatcaccaacgacaaaggtcgtctgagtaaggccgacattgagagaatg
gtgaacgaggccgagaaatacaaagaggaagacgataaacagcgtcagaggatagcggcc
cgcaatcagttagaatcctatgtcttcaccgtcaaacaggcagcagaggacacaggagac
aagcttcagtctgaagacaaagagacaatatccagggtgtgcagtgaaacagtgtcctgg
ctcgacaacaatgccctggcagaggttgacgaatatgaattcaaattgaaggaggttcag
aaggtgtgttcacctatcatggccaaactacaccagaacgggtccacgggaaatccagga
ccagctagttctagtcagggtccgactgtagaggagatggattaa

DBGET integrated database retrieval system