KEGG   Crassostrea gigas (Pacific oyster): 109617974Help
Entry
109617974         CDS       T03920                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial-like
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00970  Aminoacyl-tRNA biosynthesis
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109617974
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:crg03029]
    109617974
Enzymes [BR:crg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     109617974
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     109617974
Mitochondrial biogenesis [BR:crg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    109617974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 109617974
NCBI-ProteinID: XP_019920654
Position
Unknown
AA seq 130 aa AA seqDB search
MDEFAMGAGSTDSIFGPVRNPWNYKFAQSGEEQDKTIDWHIAGGSSGGSAVAVATGASFG
AFGSDTGGSTRNPAAYCGVVGFKSTYGRLSRHGLIPLVNSLDVPGIFAKSVDDASLLFRR
KHISAQKITL
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggatgagtttgccatgggggcaggaagcacagacagtatttttggacctgtaaggaat
ccatggaactacaaatttgcccagtcaggtgaagaacaagacaagaccattgactggcac
atcgcaggaggtagctcagggggcagtgctgttgctgtggcaacgggagccagttttggg
gcctttgggtcagacacaggtggatccactcggaacccagcggcatactgtggggtagtg
gggttcaagtccacctatggacggttgtccaggcatggcctcattcctctggttaactcc
cttgatgtgccaggaatatttgccaaaagtgtagatgatgcaagtttactgtttaggaga
aaacatataagtgctcaaaagattacactctag

DBGET integrated database retrieval system