KEGG   Candidatus Carsonella ruddii HC (Heteropsylla cubana): A353_0141Help
Entry
A353_0141         CDS       T02197                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
crh  Candidatus Carsonella ruddii HC (Heteropsylla cubana)
Pathway
crh00020  Citrate cycle (TCA cycle)
crh00620  Pyruvate metabolism
crh01100  Metabolic pathways
crh01110  Biosynthesis of secondary metabolites
crh01120  Microbial metabolism in diverse environments
crh01130  Biosynthesis of antibiotics
crh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:crh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A353_0141 (mqo)
   00620 Pyruvate metabolism
    A353_0141 (mqo)
Enzymes [BR:crh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     A353_0141 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo
Motif
Other DBs
NCBI-ProteinID: AFP83974
UniProt: J3Z167
Position
105487..106884
Genome map
AA seq 465 aa AA seqDB search
MLYNIAIIGSGIISAITNLMLYLLNKKNKILVFETNNNISLENSKAINNAGTGHSGMCEN
NYVYIINNNYFIKKNIRIYCKFNLTKNFFSWIKIFNLFNFKKIISNTPHVSFFFLKKNNK
LKNIFKKIRFYNKSIKFTNNIFILNKIFPLLIKKKKIKKNYSITYYKNGFDINYQYLSKK
IFYFLTKKKYINLYFFCNIEKIKKIKNFFLIEFFKLKKFKIIVDYIFVCAGGSTLLLLKK
FNKFISRKYFELPVNGSWLINEKKSNIIKHNLKIYSETLKNNPPMSIPHLDIRTIFNEKK
ILFGPFAGLTFKVLVNNNKTIFKNINLKFILNFIFFTIKNYSIINYLIKENFKTKKKKIF
DLFNFTKLLKKSYIKKAGKRLQILKKKKILKLTFGTKIIFNKNKKIAFLMGASPGASIVV
DIIFKLLKNWVFIPKKFLFNIKNINKKTKILNYLLYLKGIEPFSF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttatataatatagctataattggttctggtataatcagtgctataacaaatttaatg
ttatatttattaaataaaaaaaataaaattttagtatttgaaacaaataataatatttct
ttagaaaattctaaagcaattaataatgctggtactggacattcaggaatgtgtgaaaat
aattacgtttatataattaataataattattttattaaaaaaaatattagaatttattgt
aaatttaatttaacaaagaattttttttcttggataaaaatttttaatttatttaatttt
aaaaaaataatttctaataccccacatgtatcatttttttttttaaaaaaaaataataaa
ttaaaaaacatttttaaaaaaattagattttataataaatctattaaatttacaaataat
atattcattttaaataaaatatttccacttttaattaaaaaaaaaaaaataaaaaaaaat
tatagtattacttattataaaaatgggtttgatatcaattatcaatatttatcaaaaaaa
atattttattttttaacaaaaaaaaaatatattaatttatattttttttgcaatattgaa
aaaattaaaaaaattaaaaatttttttttaattgaattttttaaattaaaaaaatttaaa
ataatagtagattatatatttgtttgtgctggaggaagtactttattacttttaaaaaaa
tttaataaatttatatctagaaaatattttgaattaccagtcaacggtagttggttaata
aatgaaaaaaaaagtaatataattaaacataatttaaaaatttatagcgaaactttaaaa
aataatccaccaatgagtattccacatttagatataagaactatttttaatgaaaagaaa
attttatttggtccatttgcaggtttaacatttaaagtactagttaataataataaaact
atttttaaaaatataaatttaaaatttatattaaattttattttttttactattaaaaat
tattcaataataaattatttaattaaagaaaattttaaaactaaaaaaaaaaaaatattt
gatttatttaattttacaaaattgttaaaaaaaagttatattaaaaaagcaggtaaaagg
ttacaaattttaaaaaaaaaaaaaattttaaaattaacatttggaacaaaaattattttt
aataaaaataaaaaaattgcatttttaatgggtgcatcaccaggagcatcaatagttgta
gatataatctttaaattattaaagaattgggtgtttattcctaaaaaatttttatttaat
ataaaaaatattaataaaaaaacaaaaattttaaattatttattatatttgaaaggaatt
gaacctttttcattttga

DBGET integrated database retrieval system