KEGG   Candidatus Carsonella ruddii HC (Heteropsylla cubana): A353_0191Help
Entry
A353_0191         CDS       T02197                                 

Gene name
rplV
Definition
(GenBank) putative ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
crh  Candidatus Carsonella ruddii HC (Heteropsylla cubana)
Pathway
crh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:crh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A353_0191 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:crh03011]
    A353_0191 (rplV)
Ribosome [BR:crh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A353_0191 (rplV)
  Bacteria
    A353_0191 (rplV)
  Archaea
    A353_0191 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PH_11
Motif
Other DBs
NCBI-ProteinID: AFP84018
UniProt: J3YQ68
Position
complement(139032..139340)
Genome map
AA seq 102 aa AA seqDB search
MQNNFIFRNIPISYRKMYFYSKILSNKPILYYYKLYFHKKIDFYLIKISNTIINSCKTSN
IFIKNFFVGKGKIIKKINFRAKGRINFLEKKFCNIKIIILYG
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataattttatttttagaaatattcctatttcatatagaaaaatgtatttttac
tcaaaaattttatcaaataaaccaattttatattattataaattatattttcataaaaaa
atagatttttatttaattaaaatttcaaatacaattattaattcttgtaaaacaagtaat
atttttattaaaaattttttcgttggtaaaggaaaaataattaaaaaaattaatttcaga
gcaaaaggtagaataaattttttagaaaaaaaattttgtaatataaaaattattatttta
tatgggtaa

DBGET integrated database retrieval system