KEGG   Carnobacterium sp. 17-4: CAR_c03510Help
Entry
CAR_c03510        CDS       T01452                                 

Gene name
nagA1
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
crn  Carnobacterium sp. 17-4
Pathway
crn00520  Amino sugar and nucleotide sugar metabolism
crn01100  Metabolic pathways
crn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:crn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CAR_c03510 (nagA1)
Enzymes [BR:crn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CAR_c03510 (nagA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 DUF4795 Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AEB29072
UniProt: F4BKS0
Position
356064..357194
Genome map
AA seq 376 aa AA seqDB search
MANVLINATIYTGKEKVENAFIRFSEEILAVGKMSEYKKESTDQEQDAAGKIILPGFIDV
HSHGGYSYDNMDSSADEINQMLQEMYKEGITSYFATTMTQSYEAIDKALIAINEAASKNP
VIQGIHLEGPFVSKEFKGAQPEEFIRIPDAKQMEKWNKLSGNRIRLVTYASETSDASEFE
DYCMNNNVVLSIGHSNATRAQLMDSKASHITHLYNAQRGLHHREPGVTGHAFLEDSIYTE
MIVDGYHIHPDMVNLAYKIKGPDRIEVITDSMRAKGLPDGESELGGQKVLVKNNQARLED
GTLAGSVLTFNDAFKNIMAFTGCSIEDAVKMTSVNQAREFGLSKKGSLEAGKDADMIVMN
SEFDVEHTFSYGKMVY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgtactaataaatgcaactatttacacaggaaaagaaaaagttgaaaatgcg
tttattcgcttttcagaagaaattttagctgtaggaaaaatgagtgagtataaaaaagaa
tcaacagatcaagaacaagatgctgctggaaaaataattttaccaggttttattgatgtt
cacagtcatggtggttatagctatgacaacatggacagcagtgcagatgagatcaatcag
atgcttcaagaaatgtataaagaaggcatcacttcttactttgcaacaacaatgacacag
tcttatgaagcaattgataaagcacttatcgccatcaatgaagcagctagtaaaaatcct
gtgattcaaggaattcatttagaaggtccatttgtatcaaaagagtttaaaggagcacaa
ccagaagaattcattcgcataccagatgcaaaacaaatggaaaaatggaataaattaagt
ggaaatcgtattcgcttagtcacttatgcttctgaaactagtgatgcgtcagaatttgaa
gattattgtatgaataataacgttgttctttcaatcggtcacagcaatgcaactagagct
cagttgatggactctaaagcctctcatattacacatttgtataatgcacaaagagggctg
catcatcgcgagccaggagtaacaggacatgcgtttctagaagactcaatttatacagaa
atgattgttgacggctatcatattcatcctgatatggtcaacttagcgtataaaattaaa
ggaccagaccggattgaagtcatcacggattcgatgcgtgcaaaaggtttacctgatggc
gagagcgaattaggcgggcaaaaagtcctagtaaaaaataatcaagcaagattagaagat
ggaacgttagcaggaagtgtattgacgtttaatgatgcatttaaaaatattatggctttt
acaggttgctccattgaggatgctgtgaaaatgacttctgtcaatcaagcaagagaattt
ggtttaagtaaaaaaggcagtctcgaagcgggtaaagatgccgatatgatcgtaatgaat
agtgaatttgatgtagagcatacatttagttacggaaaaatggtttattaa

DBGET integrated database retrieval system