KEGG   Carnobacterium sp. 17-4: CAR_c04020Help
Entry
CAR_c04020        CDS       T01452                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
crn  Carnobacterium sp. 17-4
Pathway
crn00010  Glycolysis / Gluconeogenesis
crn00051  Fructose and mannose metabolism
crn00562  Inositol phosphate metabolism
crn01100  Metabolic pathways
crn01110  Biosynthesis of secondary metabolites
crn01120  Microbial metabolism in diverse environments
crn01130  Biosynthesis of antibiotics
crn01200  Carbon metabolism
crn01230  Biosynthesis of amino acids
Module
crn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
crn_M00002  Glycolysis, core module involving three-carbon compounds
crn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAR_c04020 (tpiA)
   00051 Fructose and mannose metabolism
    CAR_c04020 (tpiA)
   00562 Inositol phosphate metabolism
    CAR_c04020 (tpiA)
Enzymes [BR:crn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CAR_c04020 (tpiA)
Exosome [BR:crn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CAR_c04020 (tpiA)
  Exosomal proteins of bladder cancer cells
   CAR_c04020 (tpiA)
  Exosomal proteins of melanoma cells
   CAR_c04020 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEB29122
UniProt: F4BLS8
Position
411018..411773
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAEAAEFVEAVKTRIPSSEQVDSVIGSPALYLQSLVKASEGTELK
IAAQNSYFEEAGAFTGEISPAALGDLGVNYVIIGHSERREFFHETDEEINKKAHAIFKNG
MTPIICCGETLEQREAGETNEWVSGQVKAAIAGLTEGQIAESVIAYEPIWAIGTGKSSTS
KDANDTCAVIRQTIAKEVSQDAADAVRIQYGGSVKPENIAEYMAESDIDGALVGGASLEA
ESFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacctattattgctggtaactggaaaatgaacaaaacagctgctgaggctgct
gagtttgtagaagcagttaaaacaagaataccttcttctgaacaagtagattcagttatt
ggatctcctgctttatacttacaatcgttagttaaagcatcagaaggaacagaattaaaa
attgcagctcaaaacagctactttgaagaagctggagcattcacaggcgaaatcagtcct
gctgctttaggagacttaggagtaaactatgtaatcattggtcactctgagcgtcgtgaa
ttcttccatgaaacagatgaagaaattaataaaaaagcacatgctattttcaaaaatggt
atgactccaatcatttgctgtggtgaaacgttagaacaacgtgaagctggagaaacaaat
gaatgggtaagcggacaagttaaagcagcaattgctggcttaacagaaggtcaaatagct
gaatcagttattgcttatgaaccaatctgggcaatcggaactggcaaatcttctacttca
aaagacgcaaacgatacttgtgcagttattcgtcaaacaattgcaaaagaagtttctcaa
gatgctgctgatgctgtacgtattcaatacggcggaagtgtaaaacctgagaatattgct
gaatacatggctgaatcagatattgatggagctttagtaggaggagcaagcttagaagca
gaatcgttcttagcattattggaggctgttaaataa

DBGET integrated database retrieval system