KEGG   Carnobacterium sp. 17-4: CAR_c07270Help
Entry
CAR_c07270        CDS       T01452                                 

Gene name
ytpS
Definition
(GenBank) putative DNA translocase stage III sporulation protein
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
crn  Carnobacterium sp. 17-4
Brite
Chromosome and associated proteins [BR:crn03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CAR_c07270 (ytpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE Ftsk_gamma DUF87 AAA_10 Drf_FH1 AAA_16 TrwB_AAD_bind AAA_29 Adeno_IVa2 AAA_22 DUF853
Motif
Other DBs
NCBI-ProteinID: AEB29421
UniProt: F4BNJ6
Position
747813..750860
Genome map
AA seq 1015 aa AA seqDB search
MPKYDGPSYEKNQDRQKKFKFPFYRDAENATNKEESLKTSHLKNKDSQPTKQAIKKEEKR
SRIDFTTFQKDNNSVRNYLSTIGKEEQQKQNELKKQKKQVEKRIKQTTYSKESLKHIATP
FQEGRSSTPFKVQKIPSPYYGFQERSNKKSEETNYTTILLELEKKPEDFLLFEEHLLNES
NQSFVHTEEEQEVETIQEAEALPEVEVIQEVEALQEADVLPEADVLPEADVLPEADVLPE
ADVLPEADVLPEADVLPEADVLPEADVLPEAEALPEAEALPEAEALPEVEVLQAVETIQE
VEALPEVEILQAVETIQEVEVVSEAEVIQETEVIQEVEITQEVSDENIEATTSSSESTVV
ESSLNSTKKKRGLSRSLAGMIEEEQNVRLNRGKNVARYFGEGEALPKKAKHSIKSTRISG
KPKVQSSEEIENMELMAALSRMNYLDKQTFPTNDLKQTEKLEQSQEIIETQPETQPETQP
ETQPETQPETQPETQPETTLIDSIEKNNSSNNLEESNQDEIENTVEMNSEITAPSLEMTE
EIYDENYMFPSVDLLLRPVKLEPNAIDDWVLEQAEILNETLDAFNIHAQVIGWTIGPAVT
QFELQLGRGVKVNKITNLSDDLKLSLAAKDIRIEAPIPGKSSVGIEIPNKKSRPVMLSEV
MESKEFKESHSPLTVALGVNIAGEAVVSTIDKMPHGLIAGATGSGKSVFINSLLVSLLYK
ATPSEVRLILIDPKAVELAPYNEIPHLLSPVISEPKAASEALKWAVNEMEERYQKLAAAG
VRNIQRFNEKAEEHNDFGLKMPYIVIVIDELADLMMVASSDVQDSIARITQKARAAGIHL
IVATQRPSVDVITGTIKNNIPTRVAFMVSSQVDSRTILDTGGAEKLLGRGDMLFQENGSG
RPIRVQGTYVEKEIERIVRHVKDQRPARYLFEPESLMAKLESVEGKDELFEDVLPFIVSE
GQISASALQRKFKIGFNRAANLIESLENENFISGNKGSKPREVFLTKADYEEKFL
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatatgatggacctagttatgaaaaaaatcaagatcgccaaaaaaaattcaaa
ttccctttctatcgtgatgctgaaaacgcaacgaataaggaagagtctcttaaaacttcc
catttaaaaaataaggatagtcaaccaactaaacaagcaataaaaaaagaagaaaaacgt
tctaggattgattttacaacatttcaaaaagacaataattctgttagaaattacctttca
actattgggaaagaggaacaacaaaagcaaaatgaattaaagaaacagaaaaaacaagtt
gagaaaagaattaaacaaacgacttattcaaaagaatcgttaaaacatatagctacacca
tttcaagaagggagaagttcgactccttttaaagttcaaaagattccttctccttattat
ggctttcaagagagatccaataagaaaagtgaagaaaccaattacacaactattctttta
gaattagaaaagaaaccagaagatttcttgctatttgaagagcatttattgaacgaatca
aaccagtcttttgtacatacagaagaggaacaagaagtagaaacaatacaagaagcagaa
gcacttccggaagtagaagtgatacaagaagtagaagcacttcaagaagcagacgtacta
ccagaagcagacgtactaccagaagcagacgtactaccagaagcagacgtactaccagaa
gcagacgtactaccagaagcagacgtactaccagaagcagacgtactaccagaagcagac
gtactaccagaagcagacgtactaccagaagcagaagcactaccagaagcagaagcacta
ccagaagcagaagcactaccagaagtagaagtactacaagcagtagaaacgatacaagaa
gtagaagcactaccagaagtagaaatactacaagcagtagaaacgatacaagaagtagaa
gtagtatcagaagcagaagtaattcaagaaacagaggtaatacaagaagtagaaataaca
caagaagtatctgatgaaaatatagaagctactactagtagttctgaatcaacggttgtt
gagagctcgttaaattctacaaagaaaaaacgtgggttatctcgttctttagctggcatg
atcgaggaagagcaaaatgttcgacttaatcgcgggaaaaatgtagcaaggtattttggt
gaaggggaagccttaccaaaaaaagcaaaacattctattaaatcaacccggatttctggc
aaacctaaagttcaaagttctgaagaaatagaaaatatggaacttatggcagcactaagt
cgaatgaattatctagataaacaaacatttccaactaatgatttaaaacaaactgaaaaa
ctagaacaatctcaagaaatcattgaaacacaaccagaaacacaaccagaaacacaacca
gaaacacaaccagaaacacaaccagaaacacaaccagaaacacaaccagaaacaactctt
atcgattccattgaaaaaaataattctagcaacaatttagaagagtcaaaccaagatgaa
atagaaaatactgtagagatgaacagtgaaatcaccgctccatcattggaaatgactgaa
gaaatatatgatgaaaattatatgttcccatcagtagatcttttgcttcgtcctgtaaaa
cttgaaccaaatgcaattgacgattgggttttagaacaagcagaaatattaaatgagaca
ttagatgcttttaatatccatgctcaagtaattggttggacgattggcccagcagtcact
caatttgagcttcagttaggtcgtggcgtaaaagttaacaaaattacgaacctatctgat
gatttaaaactttcgctagcggcaaaggatattcgtatagaagctcctattcctgggaaa
agttcagtaggtattgaaattccgaataaaaagtctagacctgtgatgctatcggaagtt
atggaaagtaaagaatttaaagagagccattctcctttaacagttgcacttggggttaat
atagcaggagaagcagttgtttctactattgataaaatgcctcatggtttgattgcggga
gcaacaggttcaggaaaaagtgtctttattaattctcttttagtgagtctattatacaaa
gctacaccaagcgaagttaggttgattttaattgatccaaaagcagttgagctagctcct
tataatgaaattccacatttactttctcctgttatttctgaacctaaagcagcaagcgaa
gctttaaaatgggcagtaaatgaaatggaagaacgttaccaaaaattagcagctgcagga
gttcgaaatatccaacgctttaatgaaaaagcagaagaacataatgatttcggattgaaa
atgccttatattgtaatcgtcatcgatgaattagccgatttaatgatggtggccagtagc
gatgtgcaagattctattgcaagaattacgcaaaaagctagagcagcaggtatccactta
attgtggctacacaacgtccaagtgtagacgttattactggaacaataaaaaacaatatt
ccaactagagtagcctttatggtatctagtcaggtagactcgcggacaattttagataca
ggtggagctgaaaaacttcttggtagaggggatatgctattccaagaaaatggatcaggt
cgtccaatacgtgttcaaggaacgtatgttgaaaaagaaatagaacgaattgttagacat
gtaaaagatcaacgacctgcaaggtatctttttgagccagagtcattgatggctaaatta
gaatcagtagaaggaaaagatgaattatttgaagacgttcttccgtttattgtttctgag
gggcaaatatcagcgtcagcacttcaacggaaatttaaaataggatttaatcgagcagct
aatttgattgaatccttagaaaacgaaaattttatatcaggaaataaaggttctaaacca
cgtgaggtatttttgactaaagctgattatgaagaaaaatttctataa

DBGET integrated database retrieval system