KEGG   Carnobacterium sp. 17-4: CAR_c13410Help
Entry
CAR_c13410        CDS       T01452                                 

Gene name
thlA1
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
crn  Carnobacterium sp. 17-4
Pathway
crn00071  Fatty acid degradation
crn00072  Synthesis and degradation of ketone bodies
crn00280  Valine, leucine and isoleucine degradation
crn00310  Lysine degradation
crn00362  Benzoate degradation
crn00380  Tryptophan metabolism
crn00620  Pyruvate metabolism
crn00630  Glyoxylate and dicarboxylate metabolism
crn00640  Propanoate metabolism
crn00650  Butanoate metabolism
crn00900  Terpenoid backbone biosynthesis
crn01100  Metabolic pathways
crn01110  Biosynthesis of secondary metabolites
crn01120  Microbial metabolism in diverse environments
crn01130  Biosynthesis of antibiotics
crn01200  Carbon metabolism
crn01212  Fatty acid metabolism
crn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:crn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAR_c13410 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    CAR_c13410 (thlA1)
   00640 Propanoate metabolism
    CAR_c13410 (thlA1)
   00650 Butanoate metabolism
    CAR_c13410 (thlA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CAR_c13410 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    CAR_c13410 (thlA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CAR_c13410 (thlA1)
   00310 Lysine degradation
    CAR_c13410 (thlA1)
   00380 Tryptophan metabolism
    CAR_c13410 (thlA1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CAR_c13410 (thlA1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CAR_c13410 (thlA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CAR_c13410 (thlA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:crn04147]
    CAR_c13410 (thlA1)
Enzymes [BR:crn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CAR_c13410 (thlA1)
Exosome [BR:crn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAR_c13410 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEB30032
UniProt: F4BRW2
Position
complement(1386263..1387513)
Genome map
AA seq 416 aa AA seqDB search
MPRFKTDDPIVIVGAARTPIGAYLGGVKTVPTGELGAVALKEAIKRAGLTSEEIDEVIAG
QAMGTQEESNIGRVIGLKAGLRHQSTGMTVNRICGSGIQSAISAVQELMTMDVNFIAAGG
VESLSRSEYYLPLESRWEGFKAGNFNIIDANLALHMHAQPNAQYPEVHHMGDTAEKIAEM
YTITREEQDTYAMDSQRKAAQAIESGRLAQEIIPVEVKGRKGSITVIDADEHPRPGTNME
SLARLKPAFRKDGKGTITAGNASGLNDGAAFEIFTKASVAKERGLDVMAKIVDFAVAGCD
PNVMGLGPVYAINKVLAQNNLTLEDIDILEINEAFSAQILGCMKELGIEPGSKLYKRLNP
NGGAVALGHPLGMSGARIITSLCYEFKNHPEKKYAIASACIGGGQGIALLLENGSV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccaagatttaaaactgatgatcccattgtaattgttggagcagcgcgtacaccaatt
ggtgcttatttaggaggggtaaaaacggttcctacaggagaactgggagcggttgcgctc
aaagaggctattaaacgagctggcttaacgagtgaagagatagatgaagtcattgctggt
caagcaatgggaacacaagaggaaagcaatattggacgcgtaatagggttgaaggctggc
ttgagacatcaatcgacgggaatgacggtaaatcgcatttgtggttcgggcattcagtct
gctatttcagcagttcaagaattgatgacgatggatgttaatttcattgcagctggagga
gttgaaagtttgtctcgctcagaatattatttgccactcgaatcgagatgggaaggcttt
aaagctggaaactttaatattattgatgcaaacttagcacttcatatgcatgctcaaccc
aacgctcaataccctgaagttcatcacatgggagacactgcagaaaaaattgctgaaatg
tatacaattactagagaagaacaagatacttatgcaatggatagtcaacgcaaagctgct
caagcaattgaaagtgggcgtcttgctcaagagatcattccggttgaagtaaaagggcgc
aaaggcagtataactgtcattgatgcagatgaacatccgagaccaggaacaaatatggag
agcttagctagattaaaacctgctttccgtaaagatggtaagggtacaatcactgctggg
aatgcttctggattaaatgatggggcagcttttgaaattttcactaaagcttctgttgca
aaagagcgcggattagatgtaatggctaaaatcgttgattttgcagtagctgggtgtgac
ccaaatgtaatgggattaggtcctgtttatgcaatcaataaagttttggcacagaataat
ttgacacttgaagatatcgatattttagaaattaatgaagctttttccgctcaaatactg
ggttgtatgaaagaattaggaattgaacccggttcaaaactgtacaaacgattgaatcca
aatggtggagctgtagcgttaggtcatcctttaggaatgtctggggcacgtatcattact
tcactttgttatgaatttaaaaaccaccctgaaaaaaaatatgccattgcatcagcttgt
attggtggcggtcaaggaatcgcattattattagagaatggatctgtttaa

DBGET integrated database retrieval system