KEGG   Carnobacterium sp. 17-4: CAR_c14190Help
Entry
CAR_c14190        CDS       T01452                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
crn  Carnobacterium sp. 17-4
Pathway
crn00051  Fructose and mannose metabolism
crn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CAR_c14190 (mtlD)
Enzymes [BR:crn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CAR_c14190 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AEB30080
UniProt: F4BS10
Position
complement(1453163..1454311)
Genome map
AA seq 382 aa AA seqDB search
MLAIHFGGGNIGRGFIGEVLNKNGFKIAFVDVNKEIIDALNDKHEYTIELAQEGTPQLKV
NNVYGINNGTHPEEVIAAFEQASIVTTAIGPKILPYIAPLIAKGIQKRRAGKSTQPIDVI
ACENMIGGSTFLKEEVSKHLVKEDMDYLEQYIGFPDAAVDRIVPLQSHEDKLFVSVEGYK
EWVIDESKLKNTELRLEGVHYAPELEPFIERKLFTVNTGHATTAYVGKYEGYKTIDEALK
DEKVKKQVENVLAETGAVMVEKWQFNAEEHKAYITKILSRFMNPYISDDITRVARTPMRK
LGYDERFIRPIREASERGLETDYLIKTVAKALVYRDSNDEESQQLEKMLEDKSVETVIRE
VTQLKDETIIGKIASEYELLTK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttagccattcattttggtggaggaaatattggtcgaggatttataggagaagtctta
aataaaaatggatttaagattgcttttgtggatgtaaataaagaaatcattgatgcgcta
aatgacaaacacgaatatactattgaactggctcaagaaggcacccctcaactcaaggta
aacaatgtctatggtatcaacaatgggactcatccagaagaagtcattgcagcatttgaa
caagcttctattgtaacgactgctattggtccaaaaattttaccgtatatcgcaccttta
atcgctaaagggattcaaaaaagacgagctggaaaatcgactcaaccaattgacgtgata
gcatgtgaaaatatgattggcggaagtacattcctgaaagaggaagtttcaaaacattta
gttaaagaagatatggattaccttgaacagtatatcggatttcctgatgccgcagtggat
cgtattgttcctttgcaatctcatgaggataaattgttcgtatccgttgaaggatacaag
gaatgggtcattgatgaatctaaacttaaaaatacggaactacgtttagaaggagttcat
tatgcacctgaactagaaccctttattgaaagaaaattatttaccgtaaataccggacat
gcgactacggcctatgtcgggaaatatgaaggatacaaaacaattgacgaagcgttaaaa
gatgaaaaagtgaaaaaacaagttgagaatgttttagctgaaacaggagccgtgatggtt
gaaaaatggcagtttaatgctgaagaacacaaagcgtacattactaaaattctttcccgt
tttatgaacccatatatctcagacgatatcactcgtgttgctagaacgccaatgcgtaag
ctgggatacgacgaacggtttattcgtcctatccgagaagcaagtgaaagaggacttgaa
acagactatttgattaagactgttgctaaagctttagtctatcgtgacagcaatgatgag
gaaagccaacaattagaaaaaatgttggaagataaatctgttgaaacagttattcgtgaa
gttacgcaattaaaagatgaaacaattattgggaaaatagctagtgaatatgaactttta
acaaaataa

DBGET integrated database retrieval system