KEGG   Carnobacterium sp. 17-4: CAR_c24380Help
Entry
CAR_c24380        CDS       T01452                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
crn  Carnobacterium sp. 17-4
Pathway
crn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:crn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CAR_c24380 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:crn03011]
    CAR_c24380 (rplV)
Ribosome [BR:crn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CAR_c24380 (rplV)
  Bacteria
    CAR_c24380 (rplV)
  Archaea
    CAR_c24380 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEB31093
UniProt: F4BR52
Position
complement(2545296..2545652)
Genome map
AA seq 118 aa AA seqDB search
MAEQITEAKATAKTVRIAARKVRLVVDLIRGKSIGEAISILKFTPRGASPAIEKVLMSAI
ANAEHNYDLDVENLVVSEAYVNEGPTMKRFRPRAKGSAAPILKRTSHITVVVSEKKEG
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaaattacagaagctaaagcaactgctaaaactgttcgtattgcagctcgt
aaagttcgtttagttgtcgatcttattagagggaaaagcatcggagaagcaatttcaatt
ttgaaattcactccacgtggtgcttcgccagcaatcgaaaaagttttaatgtcagcaatt
gctaatgcagaacataactacgatttagacgtagaaaatttggtagtaagcgaagcttat
gttaacgaaggaccaacgatgaaacgtttccgtccacgtgcaaaaggatcagctgcacca
atcttgaaacgcacaagccacattacagtagtggtatctgagaaaaaggaggggtaa

DBGET integrated database retrieval system