KEGG   Citrobacter rodentium: ROD_01211Help
Entry
ROD_01211         CDS       T01145                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cro  Citrobacter rodentium
Pathway
cro00010  Glycolysis / Gluconeogenesis
cro00020  Citrate cycle (TCA cycle)
cro00620  Pyruvate metabolism
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01120  Microbial metabolism in diverse environments
cro01130  Biosynthesis of antibiotics
cro01200  Carbon metabolism
Module
cro_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ROD_01211 (aceF)
   00020 Citrate cycle (TCA cycle)
    ROD_01211 (aceF)
   00620 Pyruvate metabolism
    ROD_01211 (aceF)
Enzymes [BR:cro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ROD_01211 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H NQRA HlyD_D23 DUF1223
Motif
Other DBs
NCBI-ProteinID: CBG86901
UniProt: D2THC6
Position
144259..145869
Genome map
AA seq 536 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGKLIMIFDSADGAADAAPAPAEEKKEAAPAKAEAAPAAAAPAATGAKEVNVPD
IGGDEVEVTEVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGTVKEIKISTGDKVKTGS
LIMIFEVEGAAPAAAPAKQEAAAPAPAAKAEAPAAAAKAEGKSAFAENDAYVHATPLIRR
LAREFGVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAAASGGGLPGMLPWPKVDF
SKFGEIEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLD
VKFTPVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDV
NKKSITELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILG
VSKSAMEPVWNGKEFVPRLMMPISLSFDHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggcagatgaagttgaaatcaccgagatc
ctggtcaaggtcggcgacaaagtggaagcagagcagtcgctgatcaccgtggaaggcgac
aaagcctctatggaggtcccatctccgcaggctggcgtggttaaagagattaaagtctct
gtcggcgacaaaaccgagacgggcaaactgattatgattttcgattccgccgacggcgca
gctgacgctgcgcctgctccggcagaagagaagaaagaagcggcgccggcgaaagctgaa
gcggctccggcagcagctgcaccggcggcgaccggcgcgaaagaggttaacgtaccggat
atcggcggcgacgaagtcgaagtcaccgaagtgatggtcaaggttggcgataaagttgca
gccgaacagtcgctgatcaccgttgaaggcgataaagcgtcgatggaagtgccggcgccg
ttcgcgggcaccgtgaaagagatcaaaatcagcactggcgacaaagtgaaaaccggctct
ctgattatgatcttcgaagtggaaggcgcagcgcctgctgcggctccggcgaaacaggaa
gcggctgctccggcgcctgcggcgaaagcagaagcgccagcagcggcagcgaaagcggaa
ggtaaatctgcattcgctgaaaacgacgcctacgttcatgcaactccgctgattcgtcgc
ctggcgcgcgaattcggcgtaaacctggcgaaagtgaagggcacgggccgtaaaggtcgt
atccttcgcgaagacgttcaggcttacgtgaaagaggcgatcaaacgcgctgaggctgcg
ccagccgcggcaagcggcggcggtctgccgggcatgctgccgtggccgaaagtggacttc
agcaagtttggtgaaattgaagaagtggaactgggtcgtatccagaaaatctctggcgcc
aacctgagccgtaactgggtgatgatcccgcacgttacgcacttcgacaaaaccgacatc
accgatctggaagcgttccgcaagcagcagaacgccgaagctgagaagcgtaaactggac
gtgaagttcaccccggttgtcttcatcatgaaagccgtggctgcggcgcttgagcagatg
ccacgcttcaacagttcgctgtcggaagacggtcagcgcctgacgctgaagaaatacatc
aacatcggcgtggcggttgatacgccgaatggcctggtggttccggtctttaaagacgtg
aacaagaagagcattaccgagctgtcccgtgagctgaccactatctccaaaaaagcgcgt
gacggtaagctgaccgctggcgaaatgcagggcgggtgctttaccatctccagcatcggc
ggcctgggcaccacccacttcgcgccgattgtcaacgcgccggaagtggctatcctcggg
gtgtccaaatcggcgatggagccggtatggaacggtaaagagtttgtgccgcgtctgatg
atgccgatctctctttccttcgaccaccgcgtgatcgacggcgctgatggtgcgcgtttc
attaccatcatcaacaatatgctgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system