KEGG   Citrobacter rodentium: ROD_02971Help
Entry
ROD_02971         CDS       T01145                                 

Gene name
tagD
Definition
(GenBank) glycerol-3-phosphate cytidylyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
cro  Citrobacter rodentium
Pathway
cro00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ROD_02971 (tagD)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     ROD_02971 (tagD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FAD_syn
Motif
Other DBs
NCBI-ProteinID: CBG87081
UniProt: D2TJ75
Position
327697..328095
Genome map
AA seq 132 aa AA seqDB search
MKTVITFGTFDVFHVGHLKILQRASALGERLVVGVSSDALNIRKKGRAPVYSQSDRMDIL
AGIKGVDEVFLEESLEQKADYIRRFQADILVMGDDWRGKFDNLSWLCKVVYFPRTPSVST
TSIIEVIRIQQD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgtcatcaccttcggcaccttcgatgtctttcacgttggtcatttaaaaatt
ttgcagcgggcaagcgcgttgggagagagactggtggttggcgtttcatccgatgcgtta
aacatccgcaaaaaggggcgcgcgcccgtgtacagccagagcgaccgtatggacattctg
gcaggcatcaagggggtggatgaggtctttctcgaagagtcgctggagcaaaaagcggac
tatattcgccgctttcaggccgatattctggtgatgggcgacgactggcgaggaaaattc
gataacttatcctggctttgtaaggtggtgtattttccccgcaccccatcggtttccacc
acctccattattgaagtcatcagaatccagcaagattaa

DBGET integrated database retrieval system