KEGG   Citrobacter rodentium: ROD_04141Help
Entry
ROD_04141         CDS       T01145                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cro  Citrobacter rodentium
Pathway
cro00860  Porphyrin and chlorophyll metabolism
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01120  Microbial metabolism in diverse environments
Module
cro_M00121  Heme biosynthesis, glutamate => heme
cro_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ROD_04141 (hemB)
Enzymes [BR:cro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ROD_04141 (hemB)
Exosome [BR:cro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ROD_04141 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: CBG87196
UniProt: D2TKV5
Position
complement(464672..465646)
Genome map
AA seq 324 aa AA seqDB search
MTDLIQRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYKAIEAMPGIMRIPEKH
LAREIERIASAGIRSVMTFGISHHTDETGSDAWKEDGLVARMSRICKQTVPDMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLANLGKQAVVAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDVLRDIRERTELPLGAYQVSGEYAMIKFAAMAGAIDEEKVVLESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagacttaatccaacgcccacgtcgcctgcgcaaatccgctgcgctgcgcgccatg
tttgaagagacaacactcagcttaaacgacctggtgttgccgatctttgttgaagaagaa
ctcgacgattacaaagctatcgaggcaatgcccggcatcatgcgcattccggaaaagcat
ctggcgcgcgagatcgaacgcatcgccagcgccggtatccgctccgtcatgacctttggt
atctctcaccataccgatgaaaccggcagcgatgcctggaaagaggacggtctggtcgcc
cggatgtcacgcatctgcaaacagaccgtgccggacatgattgtaatgtcagatacctgc
ttttgtgaatatacttctcacggtcactgcggcgtcctgtgcgagcacggcgtcgataac
gacgcaacgctggccaatctcggcaagcaggccgtcgtcgcagccgcggccggggctgat
ttcatcgcgccttccgcggcaatggacgggcaagtgcaggcgattcgtcaggcgctggac
gccgccggttttaccgatacggctatcatgtcctattctaccaaattcgcctcttctttt
tatggtccgtttcgggaggcggcgggcaccgcgctgaaaggcgatcgtaaaacctaccag
atgaacccgatgaaccgtcgcgaagccattcgcgaatccctgctcgacgaagcgcagggc
gcggactgcctgatggtaaaaccggctggcgcctatcttgacgtgctgcgcgacatccgc
gaacgcacggagctaccgctcggggcctatcaggtcagcggtgagtatgcgatgatcaaa
ttcgccgccatggcgggagccattgatgaagaaaaagtggtgctggaaagcttaggggcg
atcaaacgcgcgggcgcggatctgatcttcagctacttcgcgctggatctggcggaaaag
aaaattctgcgttaa

DBGET integrated database retrieval system