KEGG   Citrobacter rodentium: ROD_10181
Entry
ROD_10181         CDS       T01145                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09911  uncharacterized protein
Organism
cro  Citrobacter rodentium
Brite
KEGG Orthology (KO) [BR:cro00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ROD_10181
SSDB
Motif
Pfam: MatP_C MatP RHH_4 FAS_I_H ELK TMF_TATA_bd
Other DBs
NCBI-ProteinID: CBG87797
UniProt: D2TS86
Position
1129853..1130251
AA seq 132 aa
MKKHREGELITRYVEASAAQEAVEMLLTLENEPVRVNVWIEEHLNPALFNRLKQTIRARR
KRHFNAEHQHTRKKSIDLEFLVWQRLAGLAQRRGKTLSETIVQLIEDAENKEKYATKMSS
LKQDLQALLGKE
NT seq 399 nt   +upstreamnt  +downstreamnt
gtgaagaagcaccgcgagggggaattaatcacccgctacgtggaggccagcgctgcccag
gaggccgtggagatgttacttactcttgaaaatgaacctgtgcgggtgaatgtctggatt
gaagagcacctgaacccggcgctgtttaaccggctgaagcagacgatacgcgccagacgt
aaacggcattttaacgctgaacatcagcatacgcgcaagaaatcaatcgatctggagttt
ctggtctggcaacgtctggcgggcctggcgcaacggcgtggcaaaacgctgtcggaaacc
atcgtgcagcttatcgaagacgccgagaataaagagaagtatgccactaagatgtcttca
ctcaagcaggacctgcaggccttgctgggaaaggagtga

DBGET integrated database retrieval system