KEGG   Citrobacter rodentium: ROD_20351Help
Entry
ROD_20351         CDS       T01145                                 

Definition
(GenBank) cellulose synthesis regulatory protein (signal transduction protein)
  KO
K21085  diguanylate cyclase [EC:2.7.7.65]
Organism
cro  Citrobacter rodentium
Brite
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     ROD_20351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHASE7 GGDEF GGDEF_2
Motif
Other DBs
NCBI-ProteinID: CBG88787
UniProt: D2TNU3
Position
complement(2137878..2139572)
Genome map
AA seq 564 aa AA seqDB search
MPHETTTENWGWLKKLARRYGPGHVVNLCFLIVMIFSTLLTWREVVVLEEAYIASQRNHL
ENVASGLDKQLQFNIDKLLFLRNGMHEALITPLNFSALKDAVSRFAELRVTQGWQLELDK
RRTLPLNGVSDAFVNQSHFLSRDGEALSNELTAALEVGYLLRLAPTQSSMAHEAMYVSRA
GFYVSTRSTPLAGEIASRYYDYVIQPWFNEQSQRQNRTRAVRWFTTPSPQLSHDEQLVTV
SVPLDSNHYWHGVLAMSIPLAGVERFMEEAIDKDVEGEYQLYDSRLRMLAASTPELRNAN
TFDARELAMLAHDIEHDTEGGLRMGSRYISWQRLDHFDGVLVRIHTLSEGVQGDFGSISI
ALVMLWTLFTAMLIISWVVIRHMVSNMFEMQSSLQWQAWHDTLTRLYNRGALFGKARHLA
QRCQAQKQPFSVIQIDLDHFKSINDRFGHQAGDRVLTHAASLISGTLRADDVAGRVGGEE
FCVVLPATTLAQAEAIAERIRQRLNEKELLVAKSTTLRISASLGVSSAQENDDYDFEQLQ
SLADRRLYLAKQMGRNRVCITDRG
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcacgaaacaacgacggaaaactggggctggctgaaaaagctggcgcgtcgatat
ggtccaggccacgtcgttaatctctgttttttaattgtcatgatcttttccaccctcctg
acctggcgggaagttgtcgtactggaagaggcctatatcgccagccagcgcaatcatctg
gaaaacgtcgccagcgggctggacaaacagctgcagtttaatatcgataagctccttttt
ctgcgtaacgggatgcacgaagcgctgatcacgccgctgaatttttccgcccttaaagat
gccgttagccgtttcgcagagttgcgagttacgcaggggtggcagcttgagctggacaag
cgccggacgctaccgctgaacggggtatctgacgcgtttgtcaaccagagtcattttctc
tcccgcgacggcgaagcgctgagcaatgagctgaccgccgcgctggaagtgggctatttg
ctgcggctggccccgacccaaagctccatggcgcacgaggcgatgtatgtttcacgggcc
ggtttttatgtctccacccgctccacgccgcttgccggagaaatagcctcccgctattac
gattacgttattcagccctggtttaatgagcagtcccagcggcagaaccgcacgcgcgcc
gtgcgctggtttacgaccccttcgccgcagttgagccatgacgagcagctggttaccgtc
agcgtaccgctggacagcaaccattactggcacggcgtgctggcgatgagtattcctctt
gccggggtggaacggtttatggaggaggccatcgataaagacgtcgagggcgaatatcag
ctttacgacagcagactgaggatgctggcggcctcaacgccggaactgcgcaacgccaat
acctttgacgcgcgcgaactggcgatgctggcgcatgacatcgagcacgacacggaaggc
ggcctgcgcatgggaagccgctatattagctggcagcggctggaccattttgacggcgtt
ctggttcgcatccataccctgagcgaaggcgtacagggggactttggcagcatcagtatc
gctctggtgatgctgtggaccctgttcaccgccatgcttatcatttcgtgggtggttatc
cgccatatggtcagcaatatgttcgagatgcaaagttcgctgcagtggcaggcctggcac
gatacgctgacccggctgtacaaccgcggcgcgctgtttggaaaagcccgccatctggcg
cagcgttgccaggcgcaaaaacagccgttctcggtcattcaaatcgatctcgaccatttc
aaaagtattaacgatcgctttggtcatcaggcgggcgatcgggtactgacccatgccgcg
agtttaatcagcggtacgctgcgggcggacgacgttgccgggcgcgtcgggggagaggag
ttctgcgtagtgctgccggcgacgacgctggcgcaggcagaggcgattgctgaacggatc
cgtcagcggctcaatgaaaaagagttgctggtggcgaaaagcacgacgctgcggatcagc
gcatcgctgggcgtcagcagcgcgcaggaaaacgatgattacgattttgaacagctacag
tcgctggccgatcgtcggctctatctggcgaaacagatgggacgcaaccgggtttgcata
acggaccgcggttaa

DBGET integrated database retrieval system