KEGG   Citrobacter rodentium: ROD_25361Help
Entry
ROD_25361         CDS       T01145                                 

Gene name
rluD
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cro  Citrobacter rodentium
Brite
KEGG Orthology (KO) [BR:cro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cro03009]
    ROD_25361 (rluD)
Enzymes [BR:cro01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     ROD_25361 (rluD)
Ribosome biogenesis [BR:cro03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ROD_25361 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 TruB_N
Motif
Other DBs
NCBI-ProteinID: CBG89279
UniProt: D2TU47
Position
complement(2681810..2682790)
Genome map
AA seq 326 aa AA seqDB search
MAQRVQLTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILDRRVLVNDKICDKPKEKVL
GGEVVAIDAEIDEEIRFEPQDIPLDIVYEDDDIIVINKPRDLVVHPGAGNPDGTVLNALL
HYYPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVEALQLREITREYEAVAIGHMT
AGGTVDEPISRHPTKRTHMSVHPMGKPAVTHYRIMEHFRVHTRLRLRLETGRTHQIRVHM
AHITHPLVGDPVYGGRPRPPKGASEAFISTLRKFDRQALHATMLRLYHPVSGIEMEWHAP
IPQDMVELIDAMRADFEEHKDDVAWL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgagtacaactcaccgcaacggtatccgaaaatcaactcggtcaacgctta
gatcaggctttggccgaaatgttcccggattattcacgttcgcgcataaaagaatggatt
ctcgatcggcgcgtgctggtcaacgataaaatttgcgacaaaccgaaagaaaaagtctta
ggcggcgaagtggtcgctatcgacgcggagattgatgaagaaatccgcttcgagcctcag
gatatcccactggatatcgtttatgaagatgatgacattattgttatcaataaaccccgc
gatctggttgtgcatcccggcgcggggaacccggacggcacggtgctgaacgcgctgctg
cactactatccgcccatcgccgacgtaccgcgcgcgggcattgtccatcgtctggataaa
gacaccaccggtctgatggtggtggcgaaaaccgttccggcgcagacgcgtctggttgag
gcgctgcagctgcgcgagatcacccgtgaatacgaagcggtcgctatcggccatatgacc
gccggcgggacggtagatgagcctatcagccgtcacccgacgaagcgtacccatatgtcg
gtgcatccgatgggcaaaccggcggtaacccactaccgtattatggaacatttccgtgtg
cacacgcgtctcaggctgcgtctggaaaccgggcgtacccaccagatccgcgtgcacatg
gcgcatattacccatccgctggtgggcgatccggtttatggcggccgcccgcgtccgccg
aaaggggcgtcggaggcgtttatctccacgctgcgcaagttcgatcgccaggcgctgcac
gccacaatgctgcgtttgtaccatcccgtttccggtatcgaaatggaatggcatgcgccg
atcccgcaggatatggttgagctgatcgacgcgatgcgcgccgatttcgaagaacataag
gatgacgtggcctggctatga

DBGET integrated database retrieval system