KEGG   Citrobacter rodentium: ROD_27641
Entry
ROD_27641         CDS       T01145                                 

Gene name
cts1D
Definition
(GenBank) T6SS lysozyme-related protein Cts1D
  KO
K11897  type VI secretion system protein ImpF
Organism
cro  Citrobacter rodentium
Brite
KEGG Orthology (KO) [BR:cro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_27641 (cts1D)
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_27641 (cts1D)
SSDB
Motif
Pfam: GPW_gp25 DUF713
Other DBs
NCBI-ProteinID: CBG89508
UniProt: D2THS6
Position
complement(2914927..2915430)
AA seq 167 aa
MSSNKSLNRGGRYLPALLERLQDDEPKSLHDRARPVDVKTIRQLVQKDITDLINHTNIED
TINEQRYKAVTESVLNYGIPALIGSHENRNNWQLIEQAIRKAIIRFEPRIIPETLLVRSL
QKKEQMAKYAVIAFEIRGLINWQPHPVDLCMNGRYDVESEKVELKLL
NT seq 504 nt   +upstreamnt  +downstreamnt
ttgtcttcaaataagtcgttaaacagaggaggccgctatctgcctgctcttctggagcgg
ctacaggatgacgaacctaaaagccttcacgatcgcgcccggcctgtcgacgttaaaacg
atacgtcagctggttcagaaagatattactgatttaattaatcataccaacatcgaggac
acgatcaatgagcaacgctataaagcagtgacagaatccgtgcttaattatggtattccg
gcgttgatcggcagccatgaaaatcgtaataactggcagcttatcgagcaggctatccgt
aaggctatcattcgcttcgaaccacgtattatccctgaaacattgctggtgcgttcattg
cagaaaaaggagcagatggcgaaatatgccgttattgcgtttgagattcgggggctaatt
aactggcagccccaccctgtagatttgtgtatgaatggtcgttacgacgtggagtctgaa
aaggtagagctgaagcttctttaa

DBGET integrated database retrieval system