KEGG   Citrobacter rodentium: ROD_27761Help
Entry
ROD_27761         CDS       T01145                                 

Gene name
cts1S
Definition
(GenBank) T6SS protein Cts1S
  KO
K11901  type VI secretion system protein ImpB
Organism
cro  Citrobacter rodentium
Brite
KEGG Orthology (KO) [BR:cro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_27761 (cts1S)
Secretion system [BR:cro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ROD_27761 (cts1S)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: CBG89519
UniProt: D2THT6
Position
complement(2929747..2930265)
Genome map
AA seq 172 aa AA seqDB search
MSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMGVLADLSGKPLEPLPPVADRK
FLSVDIDNFDERMKAMRPRVAFAVPNTLTGEGQLMVDMTFESMDDFSPDAIARKVDSLSQ
LLEARTQLANLQTYMDGKAGAESLVMKVLNDKSLLNTLASAPKPERADEVAS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagagtaactcacaaaaatttatcgcacgtaatcgtgcgccgcgcgtacaaatt
gagtacgacgtagaaatctatggcagtgaaaagaaaattgaattgccgttcgtgatgggc
gtgctggcggatttatccggtaaaccgctggagccgctgccgcctgtggcagaccgcaaa
ttcctgagtgtcgatattgataactttgacgagcgtatgaaagccatgcgtccgcgtgtc
gcgttcgcggtgccgaacaccttaacgggtgaagggcaactgatggtcgatatgaccttc
gaaagcatggatgatttttctccggatgcgattgcccgcaaagttgactcgttatctcag
ctgcttgaagcccgtacgcagctcgccaatctgcagacctatatggacggtaaagcaggc
gcggagagcctggtgatgaaggtactgaatgacaagtcgctgttgaacaccctggcatcg
gcgccaaaacctgaacgggctgatgaagtcgcgtcctga

DBGET integrated database retrieval system