KEGG   Citrobacter rodentium: ROD_28511Help
Entry
ROD_28511         CDS       T01145                                 

Gene name
mtfA
Definition
(GenBank) putative RNA 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
cro  Citrobacter rodentium
Brite
KEGG Orthology (KO) [BR:cro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cro03009]
    ROD_28511 (mtfA)
Enzymes [BR:cro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ROD_28511 (mtfA)
Ribosome biogenesis [BR:cro03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ROD_28511 (mtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ MIT_C
Motif
Other DBs
NCBI-ProteinID: CBG89591
UniProt: D2TIM9
Position
complement(3015585..3016685)
Genome map
AA seq 366 aa AA seqDB search
MNKVVLLCRPGFEKECAAEITDKAGRRELFGFARVKENAGYVIYECYQAEDADKIIRDLP
FSSLIFTRQWFVVGELLQHLPPEDRVTPIVGMLQGVVEKGGDLRVEVADTNESKELMKFC
RKFTVPLRAALRDAGVLTHYETPKRPVVHVFFIAPGCCYTGYSYAFNNSPYYMGIPRLKF
PADAPSRSTLKLEEALHVFIPQDEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVD
NGPMAQSLMDTGQVTWLREDGFKYRPNRNNISWMVCDMVEKPAKVAALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSQNLAYIQAQLDEHGVNAQMQARQLYHDREEVTVHVRRLWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtggtgttgttgtgtcgcccgggctttgaaaaagagtgcgctgcggaaatt
actgataaagcggggcgtcgcgagctgtttggtttcgcgcgcgttaaagagaacgcgggc
tatgtcatctatgaatgctatcaggctgaagacgcggacaaaatcatccgcgatctgccg
ttcagctcgctgatctttacccgtcagtggtttgtggttggcgagctgttgcagcatctg
ccgccggaagatcgcgtcacgccgatcgtcggcatgttgcagggcgttgtcgagaagggc
ggcgacctgcgcgttgaagtggcggacaccaatgaaagcaaagagctgatgaagttctgc
cgcaaatttacggtgccgctgcgcgctgcgctgcgtgacgcgggggttctgacccattac
gagacgccgaagcggccggtggttcacgtcttctttattgcgccaggctgctgttatacc
ggctactcgtatgcctttaacaactcgccgtattacatgggcattccgcgcctgaagttc
ccggccgatgcgcctagccgctcgacgctgaagctggaagaggcgctgcacgtctttatc
ccccaggatgagtgggatgaacggctggccaacggtatgtacgcggtagatttaggcgcc
tgtcccggcggctggacttatcaactggtgaaacgcaacatgtgggtgtattcggtggat
aacggcccaatggcgcagagtctgatggacaccggccaggtgacctggctgcgggaagat
ggctttaaatatcgtccgaaccgcaacaatatctcatggatggtgtgcgatatggtggaa
aaaccggcgaaagtggcggcgctgatggcgcagtggctggtgaacggctggtgtcgggaa
accattttcaacctcaagctgccgatgaaaaagcgctacgaagaggtatcgcagaacctc
gcttatattcaggcgcagcttgacgagcacggcgtgaatgcccagatgcaggcgcgtcag
ctgtaccacgatcgcgaagaggttacggtacacgtgcgtcgcctgtgggcggcggttggc
ggtcgtcgcgacgaacgctga

DBGET integrated database retrieval system